| Clone Name | bastl27h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GGLO_MOUSE (P58710) L-gulonolactone oxidase (EC 1.1.3.8) (LGO) (... | 29 | 3.8 | 2 | MYFB_YEREN (P33407) Chaperone protein myfB precursor | 28 | 5.0 | 3 | MIPR_LYMST (Q25410) Putative molluscan insulin-related peptide(s... | 28 | 8.5 |
|---|
>GGLO_MOUSE (P58710) L-gulonolactone oxidase (EC 1.1.3.8) (LGO)| (L-gulono-gamma-lactone oxidase) (GLO) Length = 439 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 85 LLELCFW*PPQLMRLVSWQQRFFPW 11 LLE W L RLV W RFF W Sbjct: 254 LLEFLLWTSTYLPRLVGWINRFFFW 278
>MYFB_YEREN (P33407) Chaperone protein myfB precursor| Length = 267 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 41 QPHQLRRLPEAKLQKLLWHR 100 +P QLR+ PE KL+WHR Sbjct: 170 RPDQLRQKPEEMAGKLIWHR 189
>MIPR_LYMST (Q25410) Putative molluscan insulin-related peptide(s) receptor| precursor (EC 2.7.10.1) [Contains: Putative molluscan insulin-related peptide(s) receptor alpha chain; Putative molluscan insulin-related peptide(s) receptor beta chain] Length = 1607 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 42 SLISCGGYQKQSSRSFSGTGNGLLTAGVVRDLDLRTSSD 158 SL CGG Q +SS F+G + L GV R+ L D Sbjct: 1360 SLTPCGGGQFKSSTHFNGGSHTLYDEGVDRETILNGVDD 1398 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,830,491 Number of Sequences: 219361 Number of extensions: 380070 Number of successful extensions: 893 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)