| Clone Name | bastl27g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit... | 69 | 5e-12 | 2 | PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit... | 69 | 5e-12 | 3 | RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Prot... | 59 | 7e-09 | 4 | RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1 | 56 | 3e-08 | 5 | RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Prot... | 53 | 3e-07 | 6 | RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1 | 46 | 4e-05 | 7 | YACF_SHIFL (Q83MF4) UPF0289 protein yacF | 29 | 5.9 |
|---|
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 68.9 bits (167), Expect = 5e-12 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +1 Query: 256 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLK 414 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG LK Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLK 107
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 68.9 bits (167), Expect = 5e-12 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +1 Query: 256 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLK 414 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLKFLRPHYG LK Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLK 107
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 58.5 bits (140), Expect = 7e-09 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = +1 Query: 259 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 411 LEL V QD P + +L +++ IR++TSSMT+VPKPLKFLRPHY TL Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRPHYFTL 107
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 56.2 bits (134), Expect = 3e-08 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +1 Query: 283 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 411 Q+ D + + ALE+M+ I+++TSSMT+VPKPLKFLRPHY T+ Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKFLRPHYETM 90
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 53.1 bits (126), Expect = 3e-07 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = +1 Query: 259 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 411 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPLKFLRP Y L Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDL 98
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 46.2 bits (108), Expect = 4e-05 Identities = 23/51 (45%), Positives = 33/51 (64%) Frame = +1 Query: 259 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTL 411 LE+ V + D + L +++ I+++TSSMT+VPKPLKFLRP Y L Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDL 99
>YACF_SHIFL (Q83MF4) UPF0289 protein yacF| Length = 247 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +1 Query: 295 PGVQRLALESMRQEIRSATSSMTSVPKPLKFLR 393 PGV + +E++ Q++++A S + S P+ +FLR Sbjct: 81 PGVDQSRIEALIQQLKAAVSVLISAPRIGQFLR 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,705,050 Number of Sequences: 219361 Number of extensions: 451765 Number of successful extensions: 2420 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2411 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)