| Clone Name | bastl27g08 |
|---|---|
| Clone Library Name | barley_pub |
>VG28_BPMU (Q9T1W6) Protein gp28| Length = 551 Score = 30.0 bits (66), Expect = 2.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 204 PGREIQIRRFRGSERYSRVTSQSRHGLLQ 290 P R+I + RF + + +T Q RHG++Q Sbjct: 301 PARDIPVLRFEAPDDFESLTPQMRHGIVQ 329
>MRS3_YEAST (P10566) Mitochondrial RNA-splicing protein MRS3| Length = 314 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 96 VLKESSFRYSSPEFSMTPVVHCSVGTIS 179 V+ ESS ++ +P P++HC G+IS Sbjct: 202 VIYESSTKFLNPSNEYNPLIHCLCGSIS 229
>XERCL_PSEAE (Q9F771) Tyrosine recombinase xerC-like| Length = 427 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 324 KRSWSSANNRLRTLSAAAVETDVAVEGSSSP 416 KRSW++ +N LRT+ A+E ++ +P Sbjct: 63 KRSWNTYSNHLRTIWGYAIEHELVTHSQVNP 93
>PCDA9_PANTR (Q5DRE3) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 285 LQPQTPFHLISMYKRSWSSANNR-LRTLSAAAVETDVAVEGSSSPS 419 L P PF L+S YK +S +R L S +A E V SPS Sbjct: 389 LTPHVPFKLVSTYKNYYSLVLDRALDRESVSAYELVVTARDGGSPS 434
>PCDA9_HUMAN (Q9Y5H5) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 285 LQPQTPFHLISMYKRSWSSANNR-LRTLSAAAVETDVAVEGSSSPS 419 L P PF L+S YK +S +R L S +A E V SPS Sbjct: 389 LTPHVPFKLVSTYKNYYSLVLDRALDRESVSAYELVVTARDGGSPS 434
>MENF_PASMU (Q9CPI5) Menaquinone-specific isochorismate synthase (EC 5.4.4.2)| (Isochorismate mutase) Length = 431 Score = 28.5 bits (62), Expect = 6.7 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 317 ADQVEWCLWLQQPMARLR 264 ADQ EWC W++Q + +++ Sbjct: 160 ADQAEWCRWVEQGLQKIK 177
>DDL_MYCSM (Q9ZGN0) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 373 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 303 FHLISMYKRSWSSANNRLRTLSAAAVETDVA 395 F ISMY R W++ TL AA V+T +A Sbjct: 337 FTTISMYPRMWAAGGIDYPTLLAAMVDTAIA 367 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,529,966 Number of Sequences: 219361 Number of extensions: 947534 Number of successful extensions: 2104 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2104 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)