Clone Name | bastl27d10 |
---|---|
Clone Library Name | barley_pub |
>DRP2A_ARATH (Q9SE83) Dynamin-2A (EC 3.6.5.5) (Dynamin-related protein 2A)| (Dynamin-like protein 6) Length = 914 Score = 61.2 bits (147), Expect = 6e-10 Identities = 32/60 (53%), Positives = 38/60 (63%) Frame = +3 Query: 201 MEAMEELSQLSESIRQXXXXXXXXXXXXXXXXXXXXTFLNAVVLGNVGSGKSAVLNSLIG 380 MEA++ELSQLS+S++Q TFLN V LGNVG+GKSAVLNSLIG Sbjct: 1 MEAIDELSQLSDSMKQAASLLADEDPDETSSSKRPATFLNVVALGNVGAGKSAVLNSLIG 60
>DRP2B_ARATH (Q9LQ55) Dynamin-2B (EC 3.6.5.5) (Dynamin-related protein 2B)| (Dynamin-like protein 3) Length = 920 Score = 59.3 bits (142), Expect = 2e-09 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = +3 Query: 201 MEAMEELSQLSESIRQXXXXXXXXXXXXXXXXXXXXTFLNAVVLGNVGSGKSAVLNSLIG 380 MEA++ELSQLS+S+RQ T LN V LGNVG+GKSAVLNSLIG Sbjct: 1 MEAIDELSQLSDSMRQAASLLADEDPDETSSSRRPATSLNVVALGNVGAGKSAVLNSLIG 60
>MRP8_ARATH (Q8VZZ4) Multidrug resistance-associated protein 8 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 8) (ATP-energized glutathione S-conjugate pump 8) Length = 1466 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 315 LNAVVLGNVGSGKSAVLNSLIG 380 +N + G VGSGKS++L+S++G Sbjct: 630 MNVAICGTVGSGKSSLLSSILG 651
>MRP11_ARATH (Q9SKX0) Multidrug resistance-associated protein 11 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 11) (ATP-energized glutathione S-conjugate pump 11) Length = 1194 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = +3 Query: 327 VLGNVGSGKSAVLNSLIG 380 V+G VGSGK+++LNSL+G Sbjct: 384 VIGEVGSGKTSLLNSLLG 401
>MRP7_ARATH (Q9LK62) Multidrug resistance-associated protein 7 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 7) (ATP-energized glutathione S-conjugate pump 7) Length = 1493 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 315 LNAVVLGNVGSGKSAVLNSLIG 380 +N + G VGSGKS++L+S++G Sbjct: 653 MNIAICGTVGSGKSSLLSSILG 674
>MRP3_ARATH (Q9LK64) Multidrug resistance-associated protein 3 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 3) (ATP-energized glutathione S-conjugate pump 3) Length = 1514 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 315 LNAVVLGNVGSGKSAVLNSLIG 380 + V G VGSGKS++L+SL+G Sbjct: 669 MKVAVCGTVGSGKSSLLSSLLG 690
>GIMA7_HUMAN (Q8NHV1) GTPase, IMAP family member 7 (Immunity-associated| nucleotide 7 protein) Length = 300 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 315 LNAVVLGNVGSGKSAVLNSLIG 380 L V++G GSGKSA N+++G Sbjct: 9 LRIVLVGKTGSGKSATANTILG 30
>MGM1_YEAST (P32266) Protein MGM1, mitochondrial precursor [Contains: Protein| MGM1 isoform 1; Protein MGM1 isoform 2] Length = 881 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 309 TFLNAVVLGNVGSGKSAVLNSLIG 380 T + VV+G+ SGKS+VL S++G Sbjct: 209 TLPSIVVIGSQSSGKSSVLESIVG 232
>MRP10_ARATH (Q9LZJ5) Multidrug resistance-associated protein 10 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 10) (ATP-energized glutathione S-conjugate pump 10) Length = 1539 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 321 AVVLGNVGSGKSAVLNSLIG 380 A ++G VGSGKS++L S++G Sbjct: 670 AAIVGTVGSGKSSLLASVLG 689
>SPN1_SCHPO (O36023) Septin homolog spn1| Length = 469 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 318 NAVVLGNVGSGKSAVLNSLI 377 N +VLG GSGKS ++N+L+ Sbjct: 97 NVLVLGESGSGKSTLVNTLL 116
>MRP9_ARATH (Q9M1C7) Multidrug resistance-associated protein 9 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 9) (ATP-energized glutathione S-conjugate pump 9) Length = 1490 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 315 LNAVVLGNVGSGKSAVLNSLIG 380 + V G VGSGKS++L+S++G Sbjct: 659 MKVAVCGAVGSGKSSLLSSILG 680 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,227,202 Number of Sequences: 219361 Number of extensions: 110392 Number of successful extensions: 917 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)