Clone Name | bastl27c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IL3RB_HUMAN (P32927) Cytokine receptor common beta chain precurs... | 29 | 6.8 | 2 | GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains:... | 29 | 6.8 | 3 | PX11C_HUMAN (Q96HA9) Peroxisomal membrane protein 11C (Peroxin-1... | 28 | 8.9 |
---|
>IL3RB_HUMAN (P32927) Cytokine receptor common beta chain precursor| (GM-CSF/IL-3/IL-5 receptor common beta-chain) (CD131 antigen) (CDw131) Length = 897 Score = 28.9 bits (63), Expect = 6.8 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = -3 Query: 398 FVTRKGANSPPWGRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNEEK*SPTLPPLLR 219 F + + PWG P+ L+G++ P FG +E S ++ + P P Sbjct: 503 FTSGSPPHQGPWGSRFPE-----LEGVF--PVGFGDSEVSPLTIEDPKHVCDPPSGPDTT 555 Query: 218 GAARDLPS 195 AA DLP+ Sbjct: 556 PAASDLPT 563
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.9 bits (63), Expect = 6.8 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = -3 Query: 377 NSPPWGRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNEEK*SPTLPPLLRGAARDLP 198 N+ P + LPD+G ++D L + P + P+ G+ + +PT GA P Sbjct: 138 NTKPRPQVLPDSGGPLIDLLTEDPPPYRDPGPPSPDGKGDSGEVAPT-----EGAPDSSP 192 Query: 197 SLTRSRSGR 171 ++R R R Sbjct: 193 MVSRLRGRR 201
>PX11C_HUMAN (Q96HA9) Peroxisomal membrane protein 11C (Peroxin-11C)| (Peroxisomal biogenesis factor 11C) (PEX11gamma) (Pex11pgamma) Length = 241 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -3 Query: 371 PPWGRSLPDTGRSILDGLYQTPRAFGGAEASQP 273 PPW L T SIL +YQ RA G AEA+ P Sbjct: 210 PPWLVGLMGTISSILS-MYQAARAGGQAEATTP 241 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,753,572 Number of Sequences: 219361 Number of extensions: 931852 Number of successful extensions: 2403 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2403 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)