Clone Name | bastl27a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CAPU_DROME (Q24120) Protein cappuccino | 25 | 4.5 | 2 | SYNJ1_BOVIN (O18964) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inos... | 29 | 4.7 | 3 | NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precu... | 29 | 4.7 | 4 | MYP_STRPU (P19615) Major yolk protein precursor (MYP) (Vitelloge... | 28 | 8.1 | 5 | SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inos... | 28 | 8.1 |
---|
>CAPU_DROME (Q24120) Protein cappuccino| Length = 1059 Score = 25.0 bits (53), Expect(2) = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 330 PPPPKPSAGARSPAP 286 PPPP P +G+ P P Sbjct: 523 PPPPPPGSGSAPPPP 537 Score = 22.7 bits (47), Expect(2) = 4.5 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 8/54 (14%) Frame = -1 Query: 450 GCGRSWESAQRRMSGRTSHGSM--------VATRRDHRCTAHSIHIIRPPPPKP 313 GC +S+ A+ + G+ V+ + H + PPPP P Sbjct: 437 GCVKSFTDAETQTESEDCEGTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPP 490
>SYNJ1_BOVIN (O18964) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) (p150) (Fragment) Length = 1324 Score = 29.3 bits (64), Expect = 4.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -1 Query: 390 SMVATRRDHRCTAHSIHIIRPPPPKPSAGARSPAP 286 ++ AT+ + ++ ++ RPPPP+P A PAP Sbjct: 1088 TLPATQLQQKDSSQTLEPKRPPPPRPVAPPARPAP 1122
>NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Neural- and thymus-derived activator for ERBB kinases) (NTAK)] Length = 868 Score = 29.3 bits (64), Expect = 4.7 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -1 Query: 417 RMSGRTSHGSMVATRRDHRCTAHSIHIIRP-----PPPKPSAGARSPA 289 R S R+S GS T ++S I RP P P+P RSPA Sbjct: 46 RSSSRSSRGSTTTTSSSENSGSNSGSIFRPAAPPEPRPQPQPQPRSPA 93
>MYP_STRPU (P19615) Major yolk protein precursor (MYP) (Vitellogenin)| Length = 1357 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -1 Query: 450 GCGRSWESAQRRMSGRTSHGSMVATRRDHRCTAHSIHIIRPPPPKP 313 G R +S ++ TS S+ T RD + +H+ RPPP P Sbjct: 958 GALRCLKSGVADLASSTSRPSVTRTLRDTDLSTGWVHLQRPPPSLP 1003
>SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1575 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 333 RPPPPKPSAGARSPAPT 283 RPPPP +GARSPAPT Sbjct: 1125 RPPPP---SGARSPAPT 1138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,234,063 Number of Sequences: 219361 Number of extensions: 579712 Number of successful extensions: 3629 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3579 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)