| Clone Name | bastl26h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2) | 60 | 1e-09 | 2 | NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3) | 60 | 1e-09 | 3 | NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5) | 60 | 1e-09 | 4 | TNR17_MOUSE (O88472) Tumor necrosis factor receptor superfamily ... | 29 | 2.6 |
|---|
>NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2)| Length = 1267 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = +2 Query: 113 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYFIPV 289 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY+ IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82 Query: 290 YDKGSFVVRVKGP 328 YDKG F+++++ P Sbjct: 83 YDKGDFILKIEPP 95
>NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3)| Length = 1222 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = +2 Query: 113 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYFIPV 289 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY+ IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82 Query: 290 YDKGSFVVRVKGP 328 YDKG F+++++ P Sbjct: 83 YDKGDFILKIEPP 95
>NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5)| Length = 1222 Score = 60.1 bits (144), Expect = 1e-09 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = +2 Query: 113 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYFIPV 289 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY+ IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82 Query: 290 YDKGSFVVRVKGP 328 YDKG F+++++ P Sbjct: 83 YDKGDFILKIEPP 95
>TNR17_MOUSE (O88472) Tumor necrosis factor receptor superfamily member 17| (B-cell maturation protein) Length = 185 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/67 (23%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 116 EIDGCGGFVEASSGLAKSRRASESKFDYS-DITVELCTVDGLVKESTQCAPNGYYFIPVY 292 ++DG +A + L + R + F S + TVE CT + VK + + ++ +P Sbjct: 89 QLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAM 148 Query: 293 DKGSFVV 313 ++G+ ++ Sbjct: 149 EEGATIL 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,462,380 Number of Sequences: 219361 Number of extensions: 486381 Number of successful extensions: 959 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)