Clone Name | bastl26h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precu... | 29 | 5.3 | 2 | SYNJ1_BOVIN (O18964) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inos... | 29 | 5.3 | 3 | NCOA2_RAT (Q9WUI9) Nuclear receptor coactivator 2 (NCoA-2) (Tran... | 29 | 6.9 | 4 | PAN1_YEAST (P32521) Protein PAN1 | 28 | 9.1 | 5 | SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inos... | 28 | 9.1 |
---|
>NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Neural- and thymus-derived activator for ERBB kinases) (NTAK)] Length = 868 Score = 29.3 bits (64), Expect = 5.3 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -3 Query: 456 RMSGRTSHGSMVATRRDHRCTAHSIHIIRP-----PPPKPSAGARSPA 328 R S R+S GS T ++S I RP P P+P RSPA Sbjct: 46 RSSSRSSRGSTTTTSSSENSGSNSGSIFRPAAPPEPRPQPQPQPRSPA 93
>SYNJ1_BOVIN (O18964) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) (p150) (Fragment) Length = 1324 Score = 29.3 bits (64), Expect = 5.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 429 SMVATRRDHRCTAHSIHIIRPPPPKPSAGARSPAP 325 ++ AT+ + ++ ++ RPPPP+P A PAP Sbjct: 1088 TLPATQLQQKDSSQTLEPKRPPPPRPVAPPARPAP 1122
>NCOA2_RAT (Q9WUI9) Nuclear receptor coactivator 2 (NCoA-2) (Transcriptional| intermediary factor 2) Length = 1465 Score = 28.9 bits (63), Expect = 6.9 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = +2 Query: 11 EERGKNRRKLNNPRGEARVFAMATAHLELLHPSPIPN 121 E+R + +L+ +G+ ++ + T + + PSP+P+ Sbjct: 623 EDRAEGHSRLHESKGQTKLLQLLTTKSDQMEPSPLPS 659
>PAN1_YEAST (P32521) Protein PAN1| Length = 1480 Score = 28.5 bits (62), Expect = 9.1 Identities = 14/61 (22%), Positives = 31/61 (50%) Frame = +2 Query: 2 WQEEERGKNRRKLNNPRGEARVFAMATAHLELLHPSPIPNLS*SKADPLPPRISHPRESA 181 W +E+ NR ++N EA++ A + +P+P+++ P+PP + P+ + Sbjct: 1280 WSDEDESNNRVAVDNKVEEAKIGHPDHARAPPVTAAPLPSVT-----PVPPAVPVPQANT 1334 Query: 182 A 184 + Sbjct: 1335 S 1335
>SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1575 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 372 RPPPPKPSAGARSPAPT 322 RPPPP +GARSPAPT Sbjct: 1125 RPPPP---SGARSPAPT 1138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,724,211 Number of Sequences: 219361 Number of extensions: 619510 Number of successful extensions: 3788 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3738 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)