Clone Name | bastl26e01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HIC1_MOUSE (Q9R1Y5) Hypermethylated in cancer 1 protein (Hic-1) | 29 | 4.9 | 2 | UL15A_HCMVA (P16844) Hypothetical protein UL15A | 29 | 6.4 | 3 | RPA1_SCHPO (P15398) DNA-directed RNA polymerase I 190 kDa polype... | 28 | 8.4 |
---|
>HIC1_MOUSE (Q9R1Y5) Hypermethylated in cancer 1 protein (Hic-1)| Length = 892 Score = 29.3 bits (64), Expect = 4.9 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -2 Query: 366 APHAAPSGHRWRHGRRPQCTRSPLPLRQ-GEQVQGPTMAGSG 244 A H+ RWRHGR C PL +R G++ T G G Sbjct: 90 AAHSPRVAARWRHGRGSVCRFGPLQIRVCGKRGGAETRPGRG 131
>UL15A_HCMVA (P16844) Hypothetical protein UL15A| Length = 102 Score = 28.9 bits (63), Expect = 6.4 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -2 Query: 330 HGRRPQCTRSPLPLRQGEQVQGPTMAGSGNGRGRL*HGQGERKGSN 193 HGR+ +C + R+G V P + GSG RG G ER+ S+ Sbjct: 8 HGRKTECQMTSAGERRGSAVGAP-ICGSGTRRG---SGANERRDSD 49
>RPA1_SCHPO (P15398) DNA-directed RNA polymerase I 190 kDa polypeptide (EC| 2.7.7.6) Length = 1689 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 89 PY-RHFLCIPAHKSPTYFTRHFSHLLLPLP 175 PY ++ +C H Y HF H++LP+P Sbjct: 56 PYLKNSVCATCHLDERYCPGHFGHIVLPIP 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,800,286 Number of Sequences: 219361 Number of extensions: 975501 Number of successful extensions: 2767 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2765 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)