Clone Name | bastl25a12 |
---|---|
Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 37.0 bits (84), Expect = 0.012 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +3 Query: 255 QLELYVVRAQDVDPGVXRLALESMRQEIRSATSSMTS 365 +LE+ V R + D + R ALE +R++IRS+T+SMTS Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTS 91
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 37.0 bits (84), Expect = 0.012 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +3 Query: 255 QLELYVVRAQDVDPGVXRLALESMRQEIRSATSSMTS 365 +LE+ V R + D + R ALE +R++IRS+T+SMTS Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTS 91
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 258 LELYVVRAQDVDPGVXRLALESMRQEIRSATSSMTS 365 LEL V QD P + +L +++ IR++TSSMT+ Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTA 92
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +3 Query: 258 LELYVVRAQDVDPGVXRLALESMRQEIRSATSSMTS 365 LEL V R ++ D + +L ++++ I+++TSSMT+ Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTA 83
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 17 VASVPLAPRTLASPPAPSPNRIRPA 91 +A VPLAP +PP+P+P R A Sbjct: 1135 LAQVPLAPPQPGAPPSPAPARFSTA 1159
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 282 QDVDPGVXRLALESMRQEIRSATSSMTS 365 Q+ D + + ALE+M+ I+++TSSMT+ Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTA 75
>BORG5_HUMAN (Q00587) Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum| protein MSE55) Length = 391 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 17 VASVPLAPRTLASPPAPSP 73 V V PR +ASPPAPSP Sbjct: 89 VRRVGAPPRRMASPPAPSP 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,021,539 Number of Sequences: 219361 Number of extensions: 211267 Number of successful extensions: 1377 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1368 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)