Clone Name | bastl24h08 |
---|---|
Clone Library Name | barley_pub |
>VPE_VICSA (P49044) Vacuolar processing enzyme precursor (EC 3.4.22.-) (VPE)| (Proteinase B) Length = 493 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 24 PCEASQDLRSPSDDDDWAATRW 89 P E S+ R P +DDD+ TRW Sbjct: 36 PSETSRFFREPKNDDDFEGTRW 57
>MYO1F_HUMAN (O00160) Myosin If (Myosin-IE)| Length = 1098 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 169 RSHQAPQRQARVPPRGAPECPGVPP 243 RS QAP R A PPRG + GVPP Sbjct: 937 RSSQAPTRAAPAPPRGM-DRNGVPP 960
>CWC27_EMENI (Q5AUG9) Peptidyl-prolyl isomerase cwc27 (EC 5.2.1.8)| Length = 558 Score = 28.1 bits (61), Expect = 6.3 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -1 Query: 246 MRRHSRAFGSTTRRYPRLSLRGLVTSTSTFAMAGAEAPPAGSLGTSTS 103 MRR + A + T+ P+ +L ++ T A+ G + PP GS+ STS Sbjct: 337 MRRTAHAPAAETK--PKSALEAMIPQT---AIRGRKRPPPGSVSASTS 379
>PEN4D_LITSE (Q962A7) Penaeidin-4d precursor (Pen-4d)| Length = 67 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 139 LCSGHREG*GRSHQAPQRQARVPPRGAPECPGVP 240 +C GH G R + P R + P G C G+P Sbjct: 16 VCQGHSSGYTRPLRKPSRPIFIRPIGCDVCYGIP 49
>SGS3_DROER (P13730) Salivary glue protein Sgs-3 precursor| Length = 328 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 10 TSPNPRAKPRKTCAPLATTT 69 T+P P R TCAP+ TTT Sbjct: 32 TTPKPCTTARPTCAPVTTTT 51
>SI1L3_HUMAN (O60292) Signal-induced proliferation-associated 1-like protein 3| (SPA-1-like protein 3) Length = 1781 Score = 27.7 bits (60), Expect = 8.2 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 139 LCSGHREG*GRSHQAPQRQARVP-PRGAPECPGVPP 243 LC G RE GRSH A +R+ P P A + G P Sbjct: 1343 LCGGGREAAGRSHHADRRREVSPAPAVAGQSKGYRP 1378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,359,458 Number of Sequences: 219361 Number of extensions: 363880 Number of successful extensions: 1844 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1843 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)