Clone Name | bastl24h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12) | 44 | 1e-04 | 2 | LOX3_ORYSA (Q7G794) Putative lipoxygenase 3 (EC 1.13.11.12) | 34 | 0.12 | 3 | RL2_XANCP (Q8PC46) 50S ribosomal protein L2 | 28 | 5.2 |
---|
>LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 110 MLLGGLIDTLTGANKSARLKG 172 MLLGGLIDTLTGANKSARLKG Sbjct: 1 MLLGGLIDTLTGANKSARLKG 21
>LOX3_ORYSA (Q7G794) Putative lipoxygenase 3 (EC 1.13.11.12)| Length = 866 Score = 33.9 bits (76), Expect = 0.12 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +2 Query: 113 LLGGLIDTLTGANKSARLKG 172 +LGG+IDT+TG++K +RLKG Sbjct: 1 MLGGIIDTITGSSKQSRLKG 20
>RL2_XANCP (Q8PC46) 50S ribosomal protein L2| Length = 275 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 82 KARRGGRE--QDAAGRADRHPHGGEQERPAQG 171 K RRG R + AA A+ HPHGG + + QG Sbjct: 211 KRRRGVRPTVRGAAMNANDHPHGGGEAKAGQG 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,082,039 Number of Sequences: 219361 Number of extensions: 310907 Number of successful extensions: 705 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)