Clone Name | bastl24h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC... | 35 | 0.069 | 2 | SC10A_RAT (Q62968) Sodium channel protein type 10 alpha subunit ... | 29 | 2.9 | 3 | TBX21_MOUSE (Q9JKD8) T-box transcription factor TBX21 (T-box pro... | 28 | 6.5 | 4 | NIFU_AZOBR (Q43909) Nitrogen fixation protein nifU | 28 | 6.5 | 5 | ACSA2_PSEPK (Q88DW6) Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1)... | 28 | 6.5 |
---|
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 34.7 bits (78), Expect = 0.069 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 141 MLTATKPLVGGACXXXXXXXXXXTFV 218 MLTATKPLVGGAC TFV Sbjct: 1 MLTATKPLVGGACAAPSSSARRRTFV 26
>SC10A_RAT (Q62968) Sodium channel protein type 10 alpha subunit (Sodium| channel protein type X alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.8) (Peripheral nerve sodium channel 3) (Sensory neuron sodium channel) Length = 1956 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = +2 Query: 62 LGRNQPRRCNLPPHRVAQ*PTP*RTHDADGDQAASRGRVCRAVVVGPAEDVRG 220 LGR + LP + Q P P R H +G G + GPA D G Sbjct: 538 LGRGAGQTGPLPRSPLPQSPNPGRRHGEEGQLGVPTGELTAGAPEGPALDTTG 590
>TBX21_MOUSE (Q9JKD8) T-box transcription factor TBX21 (T-box protein 21)| (Transcription factor TBLYM) (T-cell-specific T-box transcription factor T-bet) Length = 530 Score = 28.1 bits (61), Expect = 6.5 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = -2 Query: 210 SSAGPTTTARHTRPRLAAWSPSASWVRYGVGYCATRWGGRLHRLGWFRPS*TVQPCPGRS 31 S+ GPT + LA P A W A ++ ++ GWFRP T+ PG Sbjct: 410 SAPGPTVPYYRGQDVLA---PGAGWP------VAPQYPPKMSPAGWFRPMRTLPMDPGLG 460 Query: 30 GKEE 19 EE Sbjct: 461 SSEE 464
>NIFU_AZOBR (Q43909) Nitrogen fixation protein nifU| Length = 310 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 216 RTSSAGPTTTARHTRPRLAAWSPSASWVR 130 +T + GP T P + W+PS+ W R Sbjct: 191 KTGAVGPAQAPSPTPPARSGWTPSSRWPR 219
>ACSA2_PSEPK (Q88DW6) Acetyl-coenzyme A synthetase 2 (EC 6.2.1.1) (Acetate--CoA| ligase 2) (Acyl-activating enzyme 2) Length = 644 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 108 TRWGGRLHRLGWFRPS*TVQPCPGRSGKEEVMEGS 4 T W + RL W +P +VQ C +GK +G+ Sbjct: 37 TFWAEQAKRLDWIKPWSSVQQCDLHTGKARWFDGA 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,322,593 Number of Sequences: 219361 Number of extensions: 612540 Number of successful extensions: 1496 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1496 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)