ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl24g07 |
|---|---|
| Clone Library Name | barley_pub |
>CT055_MOUSE (Q8R184) Protein C20orf55 homolog| Length = 296 Score = 33.1 bits (74), Expect = 0.21 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +3 Query: 33 PARRPQNPPST*IGAQRSDVRPRSPRTRSDLPVPGTAVDIASSRMP 170 PA P+ PPST + +R DVRP P PGT + R P Sbjct: 139 PATPPRPPPST-VAVRRVDVRPLPASPARPYPSPGTTTTSSPGRPP 183
>AFF3_HUMAN (P51826) AF4/FMR2 family member 3 (LAF-4 protein) (Lymphoid nuclear| protein related to AF4) Length = 1227 Score = 31.2 bits (69), Expect = 0.79 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +2 Query: 32 ARAPSPKSPVYIDRRPTLGRPSPISPHPVRSASAGHRGGYSFQPDAARPVTV 187 A+APSP + G PSPISP+P +S G +G S A P T+ Sbjct: 1102 AQAPSPWGA----SGKSTGTPSPISPNPFPGSSVGSQGSLS-NASALSPSTI 1148
>FOG1_HUMAN (Q8IX07) Zinc finger protein ZFPM1 (Zinc finger protein multitype| 1) (Friend of GATA protein 1) (Friend of GATA-1) (FOG-1) Length = 1004 Score = 30.0 bits (66), Expect = 1.8 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +2 Query: 32 ARAPSPKSPVYIDRRPTLGRPSPIS---PHPVRSASAGHRGGYSFQPDAARPVT 184 +R PSP+SP + L P+P S P + A A Y F PDAA P + Sbjct: 485 SRTPSPRSPAPARVKAELSSPTPGSSPVPGELGLAGALFLPQYVFGPDAAPPAS 538
>CHS5_USTMA (O13394) Chitin synthase 5 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 5) (Class-IV chitin synthase 5) Length = 1239 Score = 28.9 bits (63), Expect = 3.9 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 11 PAAVAIDARAPSPKSPVYIDRRPTLGRPSPISPHPVRSAS-AGHRGGYSFQPDAAR 175 P ++ +RAP P S + R LG SP+ P S S AG R S P +R Sbjct: 581 PLSLKSGSRAPMPLSEKRMTRASRLGVASPLGGSPPGSPSVAGGRSSASLAPAHSR 636
>FTSKL_DEIRA (Q9RXB5) Hypothetical ftsK-like protein DR0400| Length = 980 Score = 28.9 bits (63), Expect = 3.9 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 11 PAAVAIDARAPSPKSPVYIDRRPTLG-RPSPISPHPVRSASAGHRGGYSFQPDAARP 178 PAA ++ P+P++ RP PSP+ P SAS H + +P A RP Sbjct: 430 PAAASVPQMVPTPRAAARPTPRPVSSPGPSPVPVSPA-SASVSHAAPWE-EPAAGRP 484
>SNIP1_HUMAN (Q8TAD8) Smad nuclear-interacting protein 1| Length = 396 Score = 28.5 bits (62), Expect = 5.1 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 11 PAAVAIDARAPSPKSPVYIDRRP--TLGRPSPISPHPVRSASAGHRG 145 PA V + SP+ RRP + G PSP + P RS GHRG Sbjct: 24 PAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARS---GHRG 67
>VID21_NEUCR (Q7SBU6) Chromatin modification-related protein vid-21| Length = 2189 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 35 RAPSPKSPVYIDRRPTLGRPSPI-SPHPVRSASAGHRGGYSFQPDAARPVT 184 RA +P+ +DR PT P PI S H V+ + QP + P T Sbjct: 494 RADVGPTPMDLDRIPTAQAPKPIPSVHAVQEKAPSQESARQPQPSSTAPST 544
>CT055_HUMAN (Q9BQ89) Protein C20orf55| Length = 295 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +3 Query: 33 PARRPQNPPST*IGAQRSDVRPRSPRTRSDLPVPGTAVDIASSRMP 170 P P PP + +R DVRP P PG A + +R P Sbjct: 137 PPATPPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPARPP 182
>HNRPQ_MOUSE (Q7TMK9) Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)| (hnRNP-Q) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) (Glycine-and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) (pp68) Length = 623 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 98 PISPHPVRSASAGHRGGYSFQPD 166 P P P R G RGGY + PD Sbjct: 437 PHMPPPTRGRGRGGRGGYGYPPD 459
>HNRPQ_HUMAN (O60506) Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)| (hnRNP-Q) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) (Glycine-and tyrosine-rich RNA-binding protein) (GRY-RBP) (NS1-associated protein 1) Length = 623 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 98 PISPHPVRSASAGHRGGYSFQPD 166 P P P R G RGGY + PD Sbjct: 437 PHMPPPTRGRGRGGRGGYGYPPD 459
>EMIL2_HUMAN (Q9BXX0) EMILIN-2 precursor (Elastin microfibril interface-located| protein 2) (Elastin microfibril interfacer 2) (Protein FOAP-10) Length = 1053 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 32 ARAPSPKSPVYIDRRPTLGRPSPISPH-PVRSASAGHRGGYSFQPDAARP 178 A+APSP P + P P+P P P + G R +P RP Sbjct: 786 AKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERP 835
>STNB_DROME (Q24212) Protein stoned-B (StonedB) (Stn-B)| Length = 1262 Score = 28.1 bits (61), Expect = 6.7 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 2 FLQPAAVA-IDARAPSPKSPVYIDRRPTLGRPSPISPHPVRSAS 130 F P AV I A P P +P+ RP RP+P P P A+ Sbjct: 212 FAVPTAVPNIQAAVPLPATPIKQPPRPPPPRPAPPRPAPPGQAA 255
>HNRPQ_RAT (Q7TP47) Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)| (hnRNP-Q) (Synaptotagmin-binding, cytoplasmic RNA-interacting protein) (Liver regeneration-related protein LRRG077) Length = 533 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 98 PISPHPVRSASAGHRGGYSFQPD 166 P P P R G RGGY + PD Sbjct: 347 PHMPPPTRGRGRGGRGGYGYPPD 369
>RDR1_GIBZE (Q4I0C5) Protein RDR1| Length = 544 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 29 DARAPSPKSPVYIDRRPTLGRPSPISPHPVRSASA 133 D AP P PV++D+ RP SPH ++S A Sbjct: 58 DKEAPLPSPPVHVDKD---ARPYVTSPHHLQSLEA 89
>DNAA_STRCO (P27902) Chromosomal replication initiator protein dnaA| Length = 656 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 46 PKIPRLHRSAPNARTSVPDLPAPGQ 120 P+ P+ S P R P+LPAPGQ Sbjct: 100 PQAPQSPPSRPQHRYEEPELPAPGQ 124
>NCOR2_MOUSE (Q9WU42) Nuclear receptor corepressor 2 (N-CoR2) (Silencing mediator| of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) Length = 2472 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 41 PSPKSPVYIDRRPTLGRPSPISPHPVRSASAGHRGGYSFQPDAARPVT 184 P+P S + R T +P I +R S G+ G + PD P++ Sbjct: 1967 PAPTSASDLHREKTQSKPFSIQELELR--SLGYHSGAGYSPDGVEPIS 2012
>IF35_MOUSE (Q9DCH4) Eukaryotic translation initiation factor 3 subunit 5| (eIF-3 epsilon) (eIF3 p47 subunit) (eIF3f) Length = 361 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +2 Query: 11 PAAVAIDARAPSPKSPVYIDRRPTLGRPSPISPHPVRSASA 133 P A A AP+P +P P+P+S P +A A Sbjct: 21 PVVTAAPASAPTPSTPAPTPAATPAASPAPVSSDPAVAAPA 61
>LYL1_HUMAN (P12980) Lyl-1 protein (Lymphoblastic leukemia-derived sequence 1)| Length = 267 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +2 Query: 17 AVAIDARAPSPKSPVYIDRRPTLGRPSPISPHPVRSASAGHRGGYS 154 A + A +P+P P P P SP P + GHRGG S Sbjct: 5 AEMVCAPSPAPAPP-----------PKPASPGPPQVEEVGHRGGSS 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,145,118 Number of Sequences: 219361 Number of extensions: 596257 Number of successful extensions: 2582 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2578 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
