Clone Name | bastl24f02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GATA3_XENLA (P23773) GATA-binding factor 3 (Transcription factor... | 30 | 1.7 | 2 | NAGAB_MOUSE (Q9QWR8) Alpha-N-acetylgalactosaminidase precursor (... | 29 | 3.7 | 3 | PPME1_ASPFU (Q4WKB2) Protein phosphatase methylesterase 1 (EC 3.... | 28 | 8.2 |
---|
>GATA3_XENLA (P23773) GATA-binding factor 3 (Transcription factor xGATA-3)| Length = 435 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -3 Query: 241 PWYFSNAQVSWIGLDSPSRTHAVLCHPSSLSLSAEGMSLCGRGEGIPAWNM 89 P Y+SN+ V + P +++CHPS L +G G AWN+ Sbjct: 60 PSYYSNS-VRTVPRYPPPHHGSLVCHPSILQSWTDGRKSLGGPHAASAWNL 109
>NAGAB_MOUSE (Q9QWR8) Alpha-N-acetylgalactosaminidase precursor (EC 3.2.1.49)| (Alpha-galactosidase B) Length = 415 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 138 SAEREREEG*HRTACVLDGESNPIQDTCAFEKYHG 242 S+ RER EG + A L+ PI +C++ Y G Sbjct: 160 SSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEG 194
>PPME1_ASPFU (Q4WKB2) Protein phosphatase methylesterase 1 (EC 3.1.1.-) (PME-1)| Length = 420 Score = 27.7 bits (60), Expect = 8.2 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -3 Query: 166 HPSSLSLSAEGMSLCGRGEGIPAWNMLRLVRAQEGEERNSSLSLSWF 26 HP+ S + S+ G IP+ + RA +G +SSLS S F Sbjct: 31 HPAESSHDEDSSSVSSTGTVIPSPSRQLFARASQGSSDSSSLSWSDF 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.129 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,182,407 Number of Sequences: 219361 Number of extensions: 692012 Number of successful extensions: 1473 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1473 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)