Clone Name | bastl24c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ACINU_HUMAN (Q9UKV3) Apoptotic chromatin condensation inducer in... | 28 | 4.8 |
---|
>ACINU_HUMAN (Q9UKV3) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1341 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 94 SPLRPRQ*AIAQAGGREEEMGRPGLGRRSAA 2 SPLR +Q +AQA GRP +G RS + Sbjct: 605 SPLRSKQRDVAQARTHANPRGRPKMGSRSTS 635 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.139 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,637,984 Number of Sequences: 219361 Number of extensions: 161881 Number of successful extensions: 182 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 182 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)