Clone Name | bastl24b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 pr... | 28 | 8.2 | 2 | NOTC3_MOUSE (Q61982) Neurogenic locus notch homolog protein 3 pr... | 28 | 8.2 | 3 | CCNB2_HUMAN (O95067) G2/mitotic-specific cyclin-B2 | 28 | 8.2 |
---|
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 9/36 (25%) Frame = +1 Query: 97 ISPTAAPI-WSRLAAPVGPGPS--------PDLVSP 177 ++P A P+ W+RL P PGPS P L++P Sbjct: 2163 LNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNP 2198
>NOTC3_MOUSE (Q61982) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2318 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 9/36 (25%) Frame = +1 Query: 97 ISPTAAPI-WSRLAAPVGPGPS--------PDLVSP 177 ++P A P+ W+RL P PGPS P L++P Sbjct: 2163 LNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNP 2198
>CCNB2_HUMAN (O95067) G2/mitotic-specific cyclin-B2| Length = 398 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 91 RQISPTAA--PIWSRLAAPVGPGPSPDLVS 174 +Q+ PTA+ P+ AP GP P+P+ VS Sbjct: 70 KQLKPTASVKPVQMEKLAPKGPSPTPEDVS 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,053,661 Number of Sequences: 219361 Number of extensions: 252004 Number of successful extensions: 1119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1117 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)