Clone Name | bastl23h02 |
---|---|
Clone Library Name | barley_pub |
>CWC27_ASHGO (Q75A74) Peptidyl-prolyl isomerase CWC27 (EC 5.2.1.8)| Length = 303 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 158 DRITAAAPNHPYPESRCAALHSPAPA 235 DR AAP P SRCA+L PAPA Sbjct: 240 DRRAEAAPPTDGPPSRCASLAGPAPA 265
>E75_GALME (P50239) Ecdysone-inducible protein E75| Length = 711 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 179 PNHPYPESRCAALHSPAPARSP 244 P+HP+P S HSP P R+P Sbjct: 582 PHHPHPASPAHPAHSPRPIRAP 603
>PK1L1_HUMAN (Q8TDX9) Polycystic kidney disease 1-like 1 protein| (Polycystin-1L1) Length = 2849 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 3 KPTKQMENRVPL--SSEFPTPPISYSAA*FALPRRSNLTASTGVASI 137 +PT+ RVPL S FPT P S +PR + TAS + I Sbjct: 223 RPTQTSSQRVPLWPISHFPTSPRSSHGLPPGIPRTPSFTASQSGSEI 269
>MEF2A_XENLA (Q03414) Myocyte-specific enhancer factor 2A homolog (Serum| response factor-like protein 2) (SL-2) Length = 516 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 25 IGCRSPPNSQPPQ*VTPQ-LSSHSHADQISQPAQE*LA*HSSSIIGSD 165 I +S P S P +TP SH H +P + L+ SSS GSD Sbjct: 431 INIKSEPISPPRDRITPSGFQSHQHHQHQPRPEMDSLSSSSSSYDGSD 478
>HEY1_MOUSE (Q9WV93) Hairy/enhancer-of-split related with YRPW motif 1 (Hairy| and enhancer of split-related 1) (HESR-1) Length = 299 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +2 Query: 167 TAAAPNHPYPESRCAALHSPAPA-RSP 244 TAA+P P+ + R A+ H APA R+P Sbjct: 206 TAASPTEPHHQGRLASAHPEAPALRAP 232 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,150,370 Number of Sequences: 219361 Number of extensions: 584935 Number of successful extensions: 1482 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1481 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)