Clone Name | bastl23g11 |
---|---|
Clone Library Name | barley_pub |
>DPOL_HBVW9 (P17100) P protein [Includes: DNA-directed DNA polymerase (EC| 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 845 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 16 PNSARGLRRSTHPSVRTGIGAERSGSSSLPPAAAVTD*CI 135 P + +R HPS R G E SGS + P+ + C+ Sbjct: 239 PGRSGSIRARVHPSTRRCFGVEPSGSGHVDPSVNNSSSCL 278
>DPOL_HBVDR (P03157) P protein [Includes: DNA-directed DNA polymerase (EC| 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 843 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 7 RAPPNSARGLRRSTHPSVRTGIGAERSGSSSLPPAAAVTD*CI 135 R + +R HP+ R G E SGS + +A+ T C+ Sbjct: 234 RGKSGRSGSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCL 276
>GIDA_BACTN (Q8A2N7) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 628 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 128 QSVTAAAGGREELPLRSAPIPVRTEGWVDRRRPRAE 21 + TAA R+E L +A I ++ +G++DR R AE Sbjct: 532 EKATAADSDRKEEILEAAEILIKYQGYIDRERMIAE 567
>S4A7_MOUSE (Q8BTY2) Sodium bicarbonate cotransporter 3 (Solute carrier family| 4 member 7) Length = 1034 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 194 IFLLAVPSLVPLANPCTVTI-MHQSVTAAAGGREELPLRSAPIPV 63 + + AVP+L+ CT+ I M Q +TA R+E L+ P+PV Sbjct: 781 LLIAAVPALL-----CTILIFMDQQITAVIINRKEHKLKFIPMPV 820
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 130 ISR*PPRQGGGRSCRSAPLRSQS 62 +SR PPR+G GRS P RS+S Sbjct: 749 LSRTPPRRGRGRSYSRTPSRSRS 771 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,522,332 Number of Sequences: 219361 Number of extensions: 464329 Number of successful extensions: 1653 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1650 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)