| Clone Name | bastl23f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1163_HAEIN (Q57252) Protein HI1163 | 32 | 0.54 | 2 | YDIJ_ECOLI (P77748) Hypothetical protein ydiJ | 32 | 0.54 | 3 | UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (E... | 30 | 2.1 | 4 | QUEA_RHOS4 (Q3J252) S-adenosylmethionine:tRNA ribosyltransferase... | 28 | 6.0 | 5 | LSB6_YEAST (P42951) Phosphatidylinositol 4-kinase LSB6 (EC 2.7.1... | 28 | 6.0 | 6 | LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor | 28 | 7.9 |
|---|
>Y1163_HAEIN (Q57252) Protein HI1163| Length = 1027 Score = 31.6 bits (70), Expect = 0.54 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 146 QPGGSSLHSPGFLLQPPDLARSTAICFRRAAARGWPLAAVDP 271 +P G ++H GFL + A++ A R A G PL VDP Sbjct: 826 KPNGKAMHIKGFLKRFSKTAQNQAEFLNRMAKLGIPLVGVDP 867
>YDIJ_ECOLI (P77748) Hypothetical protein ydiJ| Length = 1018 Score = 31.6 bits (70), Expect = 0.54 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 149 PGGSSLHSPGFLLQPPDLARSTAICFRRAAARGWPLAAVDP 271 P G + H GFL + A+ TA R A G P+ VDP Sbjct: 826 PNGKAQHIKGFLNRFAKTAKKTADFLNRMAKLGMPMVGVDP 866
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 128 KP*PRPQPGGSSLHSPGFLLQPPDLAR 208 KP PRPQP S PG PP AR Sbjct: 103 KPRPRPQPRARSRSQPGLSAPPPPPAR 129
>QUEA_RHOS4 (Q3J252) S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC| 5.-.-.-) (Queuosine biosynthesis protein queA) Length = 346 Score = 28.1 bits (61), Expect = 6.0 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Frame = -1 Query: 285 VPADLGSTAARGHPLAAARRKQMAVERARSGGWRR--------KPGE 169 +PA L T RG A AR + +E A +GGWR KPGE Sbjct: 62 IPARLTGTRTRGE--AEARVEVTLMEPAAAGGWRAMAKPLRKLKPGE 106
>LSB6_YEAST (P42951) Phosphatidylinositol 4-kinase LSB6 (EC 2.7.1.67)| (PI4-kinase) (PtdIns-4-kinase) Length = 607 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 231 RRKQMAVERARSGGWRRKPGEWRLDPPGW 145 R K A++ S W+ P EWRL P GW Sbjct: 406 RLKLAAIDNGLSFPWKH-PDEWRLYPYGW 433
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +2 Query: 152 GGSSLHSPGFLLQPPDLARSTAICFRRAAARGWPLAAVD 268 GG SLH P F L ++A C A ARG P D Sbjct: 41 GGFSLHPPYFNLAEGARIAASATCGEEAPARGSPRPTED 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,242,034 Number of Sequences: 219361 Number of extensions: 413340 Number of successful extensions: 1529 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1528 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)