Clone Name | bastl23f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CEA_CITFR (P04480) Colicin-A | 29 | 3.1 | 2 | IF41_WHEAT (Q03387) Eukaryotic initiation factor iso-4F subunit ... | 28 | 5.2 | 3 | BRWD1_HUMAN (Q9NSI6) Bromodomain and WD-repeat domain-containing... | 28 | 9.0 |
---|
>CEA_CITFR (P04480) Colicin-A| Length = 592 Score = 29.3 bits (64), Expect = 3.1 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 122 TGWSVVMAEGPEPDQGTAAARSTGNRRGAGEEIAEES 12 TGWS GPEP G + S G+ RG + ES Sbjct: 13 TGWSSERGSGPEPG-GGSHGNSGGHDRGDSSNVGNES 48
>IF41_WHEAT (Q03387) Eukaryotic initiation factor iso-4F subunit p82-34| (eIF-(iso)4F p82-34) Length = 788 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 103 MTTDQPVISLRPXXXXXXP 159 MTTDQPVISLRP P Sbjct: 1 MTTDQPVISLRPGGGGGGP 19
>BRWD1_HUMAN (Q9NSI6) Bromodomain and WD-repeat domain-containing protein 1| (WD-repeat protein 9) Length = 2320 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 51 PCRSSCRGALVGFGTLSHDDRPASDQPAPWRRRRR 155 P R+SCR + F + S D+ + P RRR+R Sbjct: 879 PLRTSCRRRITRFCSSSEDEISTENLSPPKRRRKR 913 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.131 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,442,883 Number of Sequences: 219361 Number of extensions: 269307 Number of successful extensions: 1150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1150 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)