Clone Name | bastl23c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adreno... | 28 | 4.5 | 2 | ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adre... | 28 | 4.5 | 3 | BIRC4_RAT (Q9R0I6) Baculoviral IAP repeat-containing protein 4 (... | 27 | 9.9 |
---|
>ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 515 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 229 SFVRSFGCNCNGGQEARRR 285 +F+R GC C GG+ RRR Sbjct: 358 AFMRILGCQCRGGRRRRRR 376
>ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 514 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 229 SFVRSFGCNCNGGQEARRR 285 +F+R GC C GG+ RRR Sbjct: 357 AFMRILGCQCRGGRRRRRR 375
>BIRC4_RAT (Q9R0I6) Baculoviral IAP repeat-containing protein 4 (Inhibitor of| apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP homolog A) (RIAP3) (RIAP-3) Length = 496 Score = 27.3 bits (59), Expect = 9.9 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 6/64 (9%) Frame = +1 Query: 130 PTCCSASGSIHT--TFPCHSHVVPLSVLVDGLVISSFVRSFGCNCNGGQ----EARRRCW 291 P CS + T +P ++H+ P + GL + C C GG+ E R W Sbjct: 158 PAMCSEEARLKTFQNWPDYAHLSPRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAW 217 Query: 292 S*YR 303 S +R Sbjct: 218 SEHR 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,737,716 Number of Sequences: 219361 Number of extensions: 417951 Number of successful extensions: 844 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)