| Clone Name | bastl23a06 |
|---|---|
| Clone Library Name | barley_pub |
>SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein| Length = 977 Score = 29.6 bits (65), Expect = 2.4 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 55 PIGAQSEPGSSAVVPPSPDLPNPQKLPR 138 P AQS P +AV+PPSP LP P PR Sbjct: 422 PPRAQSAPPEAAVLPPSP-LPAPVASPR 448
>SNX20_MOUSE (Q9D2Y5) Sorting nexin-20| Length = 313 Score = 29.3 bits (64), Expect = 3.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 28 GSPKWRNRRPIGAQSEPGSSAVVPPSPDLPNP 123 GSP WR PI V+PP PDLP P Sbjct: 8 GSPGWRG--PINQCRTRTRQEVLPPGPDLPCP 37
>MYOC_DICDI (P42522) Myosin IC heavy chain| Length = 1181 Score = 29.3 bits (64), Expect = 3.1 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 1 KQAARSPGFGSPKWRNRRPIGAQSEPGSSAVVPP----SPDLPNPQKLP 135 K+ A +PG G+P + P+ PG SA++ P S LP+P P Sbjct: 1026 KKPAPAPG-GAPMMKKPAPVPGGPAPGGSAIMKPAGGVSKPLPSPTGAP 1073
>OPGH_RALSO (Q8XVC2) Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)| Length = 862 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 34 PKWRNRRPIGAQSEPGSSAVVPPSPDLPNPQKLPR 138 P WR RR IG G++ V PD P+P+ + R Sbjct: 147 PIWRARRAIGRLFSGGTAPVPYEQPDSPDPKGIWR 181
>ACRO_PIG (P08001) Acrosin precursor (EC 3.4.21.10) (53 kDa fucose-binding| protein) [Contains: Acrosin light chain; Acrosin heavy chain] Length = 415 Score = 28.9 bits (63), Expect = 4.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 34 PKWRNRRPIGAQSEPGSSAVVPPSPDLPNPQKLP 135 P W +RP G +PGS P P P P P Sbjct: 321 PPWYFQRPPGPSQQPGSRPRPPAPPPAPPPPPPP 354
>NFH_MOUSE (P19246) Neurofilament triplet H protein (200 kDa neurofilament| protein) (Neurofilament heavy polypeptide) (NF-H) Length = 1090 Score = 28.5 bits (62), Expect = 5.4 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +3 Query: 33 PKMAKSPAD-RSPI*ARKLGS--SPSLARSPESPKAP 134 P AKSPA+ +SP A+ G SP A+SP PK+P Sbjct: 530 PGEAKSPAEAKSPGEAKSPGEAKSPGEAKSPAEPKSP 566 Score = 27.7 bits (60), Expect = 9.2 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +3 Query: 33 PKMAKSPAD-RSPI*ARKLGS--SPSLARSPESPKAP 134 P AKSPA+ +SP A+ SP A+SP PK+P Sbjct: 656 PAEAKSPAEAKSPAEAKSPAEVKSPGEAKSPAEPKSP 692
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 28.5 bits (62), Expect = 5.4 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 10/49 (20%) Frame = +1 Query: 19 PGF-----GSPKWRNRRPIGAQSEPGSSAVVPPSPD-----LPNPQKLP 135 PGF GSPK ++ + I Q P + PPSP+ PN Q+ P Sbjct: 107 PGFKHNQVGSPKKKSMKGIKQQQHPSPNQQQPPSPNQQQHPSPNQQQHP 155
>CAP1_DICDI (P19198) cAMP-binding protein CABP1A/CABP1B (CABP1 protein)| Length = 333 Score = 28.5 bits (62), Expect = 5.4 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 13 RSPGFGSPKWRNRRPIGAQSEPGSSAVVPPSPDLPN---PQKLP 135 ++PG P+ + R P GA +PG PP P P PQ+ P Sbjct: 46 QTPGGYPPQQQQRPPTGAPQQPGGYP-TPPPPGAPGGYPPQQQP 88
>OST4_HUMAN (Q9Y661) Heparan sulfate glucosamine 3-O-sulfotransferase 4 (EC| 2.8.2.23) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4) (Heparan sulfate 3-O-sulfotransferase 4) (h3-OST-4) Length = 456 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 55 PIGAQSEPGSSAVVPPSPDLPNPQKLP 135 P+ Q PG++A PPSP P P LP Sbjct: 62 PLALQESPGAAAEPPPSP--PPPSLLP 86
>CYSD_SCHPO (O13326) O-acetylhomoserine (thiol)-lyase (EC 2.5.1.49)| (O-acetylhomoserine sulfhydrylase) (OAH sulfhydrylase) (Homocysteine synthase) Length = 429 Score = 27.7 bits (60), Expect = 9.2 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 101 GGTTAELPGSDWAPIGRRFRHFGEPNPG 18 GG + DW +RF F EP+PG Sbjct: 220 GGVIVDSGKFDWKKNSKRFPEFNEPHPG 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.132 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,118,656 Number of Sequences: 219361 Number of extensions: 478226 Number of successful extensions: 1950 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1937 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)