ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl22g11 |
|---|---|
| Clone Library Name | barley_pub |
>TTP_RAT (P47973) Tristetraproline (TTP) (Zinc finger protein 36) (Zfp-36)| (TIS11A protein) (TIS11) Length = 320 Score = 30.8 bits (68), Expect = 1.3 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 245 PRSRLTQPPAPSSTATVLACPPRLSSCSYRVTRTSPPP 132 P R T PP P + P LSSCS+ + + PPP Sbjct: 184 PSGRRTSPPPPGFSG------PSLSSCSFSPSSSPPPP 215
>SPE1_BRAJU (O82475) Arginine decarboxylase (EC 4.1.1.19) (ARGDC) (ADC)| Length = 702 Score = 30.8 bits (68), Expect = 1.3 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 224 PPAPSSTATVLACPPRLSSCSYRVTRTSPPPLAASNS 114 PP+P+S++ L P LSS YR+ P AA++S Sbjct: 24 PPSPNSSSASLDWSPSLSSSLYRIDGWGAPYFAANSS 60
>CLCKB_MOUSE (Q9WUB6) Chloride channel protein ClC-Kb (Chloride channel Kb)| (ClC-K2) Length = 687 Score = 30.8 bits (68), Expect = 1.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 275 GYVTWLKLMKPRSRLTQPPAP 213 G+V+W++L K S LT PPAP Sbjct: 666 GFVSWVELKKAISTLTNPPAP 686
>DPO3X_SALTY (P74876) DNA polymerase III tau subunit (EC 2.7.7.7) [Contains: DNA| polymerase III gamma subunit] Length = 642 Score = 30.4 bits (67), Expect = 1.7 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = -1 Query: 245 PRSRLTQPPAPSST-----ATVLACPPRLSSCSYRVTRTSPPPLAASNS 114 PR L +P P + T + PP+L S +TSP PL AS S Sbjct: 361 PRMPLPEPETPRQSFAPVAPTAVMTPPQLQQPSAPAPQTSPAPLPASTS 409
>K0310_HUMAN (O15027) Protein KIAA0310| Length = 2179 Score = 29.6 bits (65), Expect = 2.9 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 305 PSPSNHSVMWGYVT--WLKLMKPRSRLTQPPAP--SSTATVLACPPRL 174 P N S++W W+ L +P PP P S TV A PP L Sbjct: 1946 PDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPAL 1993
>TTP_MOUSE (P22893) Tristetraproline (TTP) (Zinc finger protein 36) (Zfp-36)| (TIS11A protein) (TIS11) (Growth factor-inducible nuclear protein NUP475) (TPA-induced sequence 11) Length = 319 Score = 29.3 bits (64), Expect = 3.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 245 PRSRLTQPPAPSSTATVLACPPRLSSCSYRVTRTSPPP 132 P R + PP P + P LSSCS+ + + PPP Sbjct: 183 PSGRRSSPPPPGFSG------PSLSSCSFSPSSSPPPP 214
>ERFB_EMENI (Q5B3W7) Palmitoyltransferase erf2 (EC 2.3.1.-) (DHHC cysteine-rich| domain-containing protein erf2) (Ras protein acyltransferase) Length = 601 Score = 29.3 bits (64), Expect = 3.8 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = -1 Query: 239 SRLTQPPAPSSTATVLACPPRLSSCSYRVTRTSPPPLAAS 120 SR PPA SS A+ R S + R++RT P LAAS Sbjct: 64 SRRGPPPARSSIASTSQITNRPGSSASRLSRTHIPSLAAS 103
>WASF3_HUMAN (Q9UPY6) Wiskott-Aldrich syndrome protein family member 3| (WASP-family protein member 3) (WAVE-3 protein) (Verprolin homology domain-containing protein 3) Length = 502 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -1 Query: 251 MKPRSRLTQPPAPSSTATVLACPPRLSSCSYRVTRTSPP 135 + P QPP P+S ++ A PP S VT PP Sbjct: 360 VSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPP 398
>CLCKB_RAT (P51802) Chloride channel protein ClC-Kb (Chloride channel Kb)| (ClC-K2) Length = 687 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 275 GYVTWLKLMKPRSRLTQPPAP 213 G V+W++L K S LT PPAP Sbjct: 666 GSVSWVELKKAISTLTNPPAP 686
>3BP1_MOUSE (P55194) SH3 domain-binding protein 1 (3BP-1)| Length = 601 Score = 28.9 bits (63), Expect = 5.0 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 6/46 (13%) Frame = -1 Query: 248 KPRSRLTQPPAPS------STATVLACPPRLSSCSYRVTRTSPPPL 129 +P S + PPAPS S T A P RL S R T PPPL Sbjct: 491 QPSSTRSSPPAPSLPPGSVSPGTPQALPRRLVGTSLRAP-TMPPPL 535
>CLCKB_HUMAN (P51801) Chloride channel protein ClC-Kb (Chloride channel Kb)| (ClC-K2) Length = 687 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 275 GYVTWLKLMKPRSRLTQPPAP 213 G V+W+++ K S LT PPAP Sbjct: 666 GCVSWVEMKKAISNLTNPPAP 686
>CLCKA_HUMAN (P51800) Chloride channel protein ClC-Ka (Chloride channel Ka)| (ClC-K1) Length = 687 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 275 GYVTWLKLMKPRSRLTQPPAP 213 G V+W+++ K S LT PPAP Sbjct: 666 GCVSWVEMKKAISNLTNPPAP 686
>TBC10_HUMAN (Q9BXI6) TBC1 domain family member 10A (EBP50-PDX interactor of 64| kDa) (EPI64 protein) Length = 508 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = -1 Query: 257 KLMKPRSRLTQPPAPSSTATVL----ACPPR 177 K MK R +L +PPAP+ V ACPP+ Sbjct: 437 KQMKGRGQLEKPPAPNQAMVVAAAGDACPPQ 467
>NEB2_HUMAN (Q96SB3) Neurabin-2 (Neurabin-II) (Spinophilin) (Protein| phosphatase 1 regulatory subunit 9B) Length = 815 Score = 28.5 bits (62), Expect = 6.6 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = -1 Query: 257 KLMKPRSRLTQPPAP-------SSTATVLACPPRLSSCSYRVTRTSPPP 132 KL+ RSR+ QPP P + A CP +RV PPP Sbjct: 240 KLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQHRVAPARPPP 288
>LIC4_ASHGO (Q751A7) Protein ATC1/LIC4| Length = 304 Score = 28.5 bits (62), Expect = 6.6 Identities = 22/86 (25%), Positives = 31/86 (36%) Frame = +1 Query: 112 HELLAASGGGDVRVTLYEQEESLGGHARTVAVDDGAGGCVNLDLGFMSFNQVTYPHMTEW 291 H A+ GGDV + + LG V V +GA G V++D YPH Sbjct: 22 HSSAGATVGGDVHLDTLTMDGILGNEEPFVQVHEGALGSVDMD-------GQRYPHGRNS 74 Query: 292 LEGLGVEMERSDMSFSVSKQPEGNGR 369 L + S + +G R Sbjct: 75 LSSIVGSKAIIQQSMDIHPTAQGGAR 100
>HISX_SALPA (Q5PDP3) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 434 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 209 STATVLACPPRLSSCSYRVTRTSPPPLA 126 ST +LA P R++ C +V SPPP+A Sbjct: 140 STVLMLATPARIAGCQ-KVVLCSPPPIA 166
>CHI1_RHIOL (P29026) Chitinase 1 precursor (EC 3.2.1.14)| Length = 540 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 311 STPSPSNHSVMWGYVTWLKLMKPRSRLTQPPAPSSTATVLACPPRLSSCS 162 STP PS+ ++ T K ++ T AP++T+ +CP SCS Sbjct: 316 STPPPSSSTIK----TTTKATTTSTKTTTTAAPTATSAPGSCPVANQSCS 361
>UBAX1_ARATH (Q7Y175) UBA and UBX domain-containing protein At4g15410| Length = 421 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 230 TQPPAPSSTATVLACPPRLSSCSYRVTRTSPPP 132 T PP PSST P + S Y + TSP P Sbjct: 56 TGPPPPSSTIAGAQSPSQSHSPDYTPSETSPSP 88
>NOTC3_RAT (Q9R172) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2319 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -1 Query: 191 ACPPRLSSCSYRVTRTSPPPLAASNSC 111 ACPP LS S RV+R SP A + SC Sbjct: 1316 ACPPGLSGPSCRVSRASPSG-ATNTSC 1341
>WASF3_MOUSE (Q8VHI6) Wiskott-Aldrich syndrome protein family member 3| (WASP-family protein member 3) (WAVE-3 protein) Length = 501 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -1 Query: 251 MKPRSRLTQPPAPSSTATVLACPPRLSSCSYRVTRTSPP 135 + P TQPP P+S + PP S T PP Sbjct: 360 VSPLQMPTQPPFPASAVSTYPTPPHQPSTGLLATAPPPP 398
>HISX_SALTY (P10370) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 433 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 209 STATVLACPPRLSSCSYRVTRTSPPPLA 126 ST +LA P R++ C +V SPPP+A Sbjct: 139 STVLMLATPARIAGCQ-KVVLCSPPPIA 165
>HISX_SALTI (Q8Z5K0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 433 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 209 STATVLACPPRLSSCSYRVTRTSPPPLA 126 ST +LA P R++ C +V SPPP+A Sbjct: 139 STVLMLATPARIAGCQ-KVVLCSPPPIA 165
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 28.1 bits (61), Expect = 8.6 Identities = 20/68 (29%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -1 Query: 311 STPSPSNHSVMWGYVTWLKLMKPRSRLTQPPA--PSSTATVLACPPRLSSCSYRVTRTSP 138 +TPSP T + P S T PP PS T PP ++ S T T Sbjct: 1616 TTPSPP---------TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS 1666 Query: 137 PPLAASNS 114 PP+ + + Sbjct: 1667 PPITTTTT 1674
>HISX_YERPS (Q66C49) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 443 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 221 PAPSSTATVLACPPRLSSCSYRVTRTSPPPLA 126 P PS T +L P R++ C RV SPPP+A Sbjct: 140 PLPS-TVLMLGTPARIAGCQ-RVVLCSPPPIA 169
>HISX_YERPE (Q8ZFX5) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 443 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 221 PAPSSTATVLACPPRLSSCSYRVTRTSPPPLA 126 P PS T +L P R++ C RV SPPP+A Sbjct: 140 PLPS-TVLMLGTPARIAGCQ-RVVLCSPPPIA 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,996,055 Number of Sequences: 219361 Number of extensions: 804548 Number of successful extensions: 3746 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3736 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
