| Clone Name | bastl22g10 |
|---|---|
| Clone Library Name | barley_pub |
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.9 bits (63), Expect = 3.2 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = -2 Query: 365 NSPPWGRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNEEK*SPTLPPLLRGAARDLP 186 N+ P + LPD+G ++D L + P + P+ G+ + +PT GA P Sbjct: 138 NTKPRPQVLPDSGGPLIDLLTEDPPPYRDPGPPSPDGKGDSGEVAPT-----EGAPDSSP 192 Query: 185 SLTRSRSGR 159 ++R R R Sbjct: 193 MVSRLRGRR 201
>PX11C_HUMAN (Q96HA9) Peroxisomal membrane protein 11C (Peroxin-11C)| (Peroxisomal biogenesis factor 11C) (PEX11gamma) (Pex11pgamma) Length = 241 Score = 28.5 bits (62), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 359 PPWGRSLPDTGRSILDGLYQTPRAFGGAEASQP 261 PPW L T SIL +YQ RA G AEA+ P Sbjct: 210 PPWLVGLMGTISSILS-MYQAARAGGQAEATTP 241
>IL3RB_HUMAN (P32927) Cytokine receptor common beta chain precursor| (GM-CSF/IL-3/IL-5 receptor common beta-chain) (CD131 antigen) (CDw131) Length = 897 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = -2 Query: 356 PWGRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNEEK*SPTLPPLLRGAARDLPS 183 PWG P+ L+G++ P FG +E S ++ + P P AA DLP+ Sbjct: 513 PWGSRFPE-----LEGVF--PVGFGDSEVSPLTIEDPKHVCDPPSGPDTTPAASDLPT 563
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 28.1 bits (61), Expect = 5.5 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = -2 Query: 365 NSPPWGRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNEEK*SPTLPPLLRGAARDLP 186 N+ P + LPD+G ++D L + P + S + +G + +PT GA P Sbjct: 139 NTKPRPQVLPDSGGPLIDLLTEDPPPYRDPGPSSSDGNGGSGEVAPT-----EGAPDSSP 193 Query: 185 SLTRSRSGR 159 ++R R R Sbjct: 194 MVSRLRGRR 202
>SYTL2_HUMAN (Q9HCH5) Synaptotagmin-like protein 2 (Exophilin-4)| Length = 895 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -2 Query: 272 ASQPNVDGNEEK*SPTLPPLLRGAARDLPS 183 +S+ G+EE+ SP L L R AAR +PS Sbjct: 465 SSRDRQQGSEEEPSPVLKTLERSAARKMPS 494
>GAG_MLVFF (P26806) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = -2 Query: 365 NSPPWGRSLPDTGRSILDGLYQTPRAFGGAEASQPNVDGNEEK*SPTLPPLLRGAARDLP 186 N+ P + LPD+G ++D L + P + P+ +G+ + +PT GA P Sbjct: 138 NTKPRPQVLPDSGGPLIDLLTEDPPPYRDPGPPSPDGNGDSGEVAPT-----EGAPDPSP 192 Query: 185 SLTRSR 168 ++R R Sbjct: 193 MVSRLR 198
>SECY_SYNP7 (P0A4H0) Preprotein translocase secY subunit| Length = 439 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 228 WALLLFIPVDVWLTGFRPTESPRCLIQT 311 WALL I + VW+T + T P IQT Sbjct: 135 WALLQSIVIAVWVTRYAVTPGPLFTIQT 162
>SECY_SYNP6 (P0A4H1) Preprotein translocase secY subunit| Length = 439 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 228 WALLLFIPVDVWLTGFRPTESPRCLIQT 311 WALL I + VW+T + T P IQT Sbjct: 135 WALLQSIVIAVWVTRYAVTPGPLFTIQT 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,413,452 Number of Sequences: 219361 Number of extensions: 601596 Number of successful extensions: 1546 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1546 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)