Clone Name | bastl22f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MUCDL_HUMAN (Q9HBB8) Mucin and cadherin-like protein precursor (... | 33 | 0.44 | 2 | TRXB_ASHGO (Q75CM8) Thioredoxin reductase (EC 1.8.1.9) | 32 | 0.97 | 3 | METW_YEAST (Q12198) Putative cystathionine gamma-synthase YLL058... | 30 | 3.7 | 4 | CACB2_MOUSE (Q8CC27) Voltage-dependent L-type calcium channel be... | 29 | 4.8 | 5 | RS5_SYNPX (Q7U4I4) 30S ribosomal protein S5 | 29 | 6.3 |
---|
>MUCDL_HUMAN (Q9HBB8) Mucin and cadherin-like protein precursor| (Mu-protocadherin) Length = 845 Score = 32.7 bits (73), Expect = 0.44 Identities = 18/55 (32%), Positives = 23/55 (41%) Frame = -2 Query: 263 TTTSQGSGPDARPSNGGALRPDMAAEKPCGRGGGRSDRVEERVNPRGDEVSGRKP 99 +TTS G G P +G LRP + P G G + + P GD KP Sbjct: 492 STTSSGGGTGPHPPSGTTLRPP-TSSTPGGSPGAENSTSHQPATPGGDTAQTPKP 545
>TRXB_ASHGO (Q75CM8) Thioredoxin reductase (EC 1.8.1.9)| Length = 319 Score = 31.6 bits (70), Expect = 0.97 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = -1 Query: 381 RAKLKSTCNFGTKSR*IQSEVCSVDIAIEPLKCVTIFDLDDDVPXXXXXXXXXXXXXAQA 202 R K +S FGT+ + V VD++ P K T F+ D++ + Sbjct: 70 RMKAQSV-KFGTEV--VTETVAKVDLSARPFKLWTEFNEDEEPTTTDAIILATGASAKRL 126 Query: 201 GHGGRETLWER 169 G G ET W+R Sbjct: 127 GLPGEETYWQR 137
>METW_YEAST (Q12198) Putative cystathionine gamma-synthase YLL058W (EC| 2.5.1.48) (O-succinylhomoserine (thiol)-lyase) Length = 575 Score = 29.6 bits (65), Expect = 3.7 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +1 Query: 280 DTLKRFNGYVNGTHFTLNLS----ALRSKIASAFKFGPDADFI 396 D+LK F G NGT+FTL A S++ KFG D + I Sbjct: 502 DSLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGADPNII 544
>CACB2_MOUSE (Q8CC27) Voltage-dependent L-type calcium channel beta-2 subunit| (CAB2) (Calcium channel, voltage-dependent, beta 2 subunit) Length = 655 Score = 29.3 bits (64), Expect = 4.8 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -2 Query: 290 LSVSPYLTLTTTSQGSGPDARPSNGGALRPDMAAEKPC 177 L +SP TL + SQGS D RP A E+PC Sbjct: 482 LPLSP--TLASNSQGSQGDQRPDRSAPRSASQAEEEPC 517
>RS5_SYNPX (Q7U4I4) 30S ribosomal protein S5| Length = 215 Score = 28.9 bits (63), Expect = 6.3 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 266 LTTTSQGSGPDARPSNGGALRPDMAAEKPCGRGGGRSDRVEERVNPRGD 120 +T +S S P+A P ++ RGGGR +R + R RGD Sbjct: 1 MTDSSPQSNPNAVPGAADVPAAAEGQQQEQRRGGGRGERGDRRGGRRGD 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,091,877 Number of Sequences: 219361 Number of extensions: 825246 Number of successful extensions: 3772 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3772 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)