Clone Name | bastl22c09 |
---|---|
Clone Library Name | barley_pub |
>ATG15_ASPFU (Q4X180) Putative lipase atg15 (EC 3.1.1.3) (Autophagy-related| protein 15) Length = 650 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -1 Query: 163 WFCLESGQRTVHSTASNSCSPFSSPL---YPKCHSMIFFGTSCI 41 W C + H S +P+S+P C S IFFG C+ Sbjct: 599 WGCYDESTTATHPITSGPSAPYSTPSPTHEHTCTSSIFFGLICV 642
>HEM6_SHEON (Q8EKQ2) Coproporphyrinogen 3 oxidase, aerobic (EC 1.3.3.3)| (Coproporphyrinogen III oxidase, aerobic) (Coproporphyrinogenase) (Coprogen oxidase) Length = 302 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 181 GLPVNRWFCLESGQRTVHSTASNSCSPFSSPLYPK 77 G + ++ E R H +A N C PF +YPK Sbjct: 130 GFDLTPYYPFEEDVREWHQSAKNLCQPFGDDVYPK 164
>PRDM8_HUMAN (Q9NQV8) PR domain zinc finger protein 8 (PR domain-containing| protein 8) Length = 689 Score = 29.3 bits (64), Expect = 3.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 245 PIDHYPVPLANGTHPQMAKGGEGFECSSTIHH 340 P+ HYP P ++P A GG + S+ H+ Sbjct: 232 PLHHYPSPSPESSNPSAAAGGSSAKPSTDFHN 263
>GPR87_HUMAN (Q9BY21) Probable G-protein coupled receptor 87 (G-protein coupled| receptor 95) Length = 358 Score = 28.9 bits (63), Expect = 5.2 Identities = 19/68 (27%), Positives = 32/68 (47%) Frame = -1 Query: 217 ITPCLWEENNNIGLPVNRWFCLESGQRTVHSTASNSCSPFSSPLYPKCHSMIFFGTSCIH 38 ++ C+W + LP L +GQ T + + CS SPL K H+ + + SC+ Sbjct: 161 LSVCVWVIMAVLSLPN---IILTNGQPTEDNI--HDCSKLKSPLGVKWHTAVTYVNSCLF 215 Query: 37 LPASIISI 14 + +I I Sbjct: 216 VAVLVILI 223
>GRPR_RAT (P52500) Gastrin-releasing peptide receptor (GRP-R) (GRP-preferring| bombesin receptor) Length = 384 Score = 28.9 bits (63), Expect = 5.2 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -1 Query: 112 SCSPF--SSPLYPKCHSMIFFGTSCIHLPASIISI 14 SC+P+ S+ L+PK HSM F I +P SIIS+ Sbjct: 196 SCAPYPHSNELHPKIHSMASFLVFYI-IPLSIISV 229
>SYV_METJA (Q58413) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 878 Score = 28.5 bits (62), Expect = 6.7 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 3/73 (4%) Frame = +3 Query: 204 KQGVILGWTCYLSIQLIIT---LCHLRMELIRKWRKVVKDLSVPRRFIMQKLAISMLNFG 374 KQ V + W C I++I+T ++R +LI K R+V ++ ++I + + I +LN+ Sbjct: 334 KQNVGVCWRCKTPIEIIVTEQWFVNVR-KLIPKVREVADEI----KWIPEHMKIRLLNWI 388 Query: 375 DELHTEAIIENAR 413 +++ + +I R Sbjct: 389 EDMDWDWVISRQR 401
>HEM6_LEGPH (Q5ZW72) Coproporphyrinogen 3 oxidase, aerobic (EC 1.3.3.3)| (Coproporphyrinogen III oxidase, aerobic) (Coproporphyrinogenase) (Coprogen oxidase) Length = 311 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 130 HSTASNSCSPFSSPLYPK 77 H TA N+C PF +YPK Sbjct: 153 HQTALNACLPFGETIYPK 170
>HEM6_LEGPA (Q5X5U7) Coproporphyrinogen 3 oxidase, aerobic (EC 1.3.3.3)| (Coproporphyrinogen III oxidase, aerobic) (Coproporphyrinogenase) (Coprogen oxidase) Length = 311 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 130 HSTASNSCSPFSSPLYPK 77 H TA N+C PF +YPK Sbjct: 153 HQTALNACLPFGETIYPK 170
>CPB1_CAEJA (Q6E3C7) Cytoplasmic polyadenylation element-binding protein 1| Length = 617 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 Query: 86 LPKVPQHDLLRYFLYPSPRQHH*HYHNN 3 LP+ P H Y +P HH H H N Sbjct: 539 LPRPPHHSTSHYHHRSTPSHHHNHTHQN 566
>GRPR_HUMAN (P30550) Gastrin-releasing peptide receptor (GRP-R) (GRP-preferring| bombesin receptor) Length = 384 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -1 Query: 112 SCSPF--SSPLYPKCHSMIFFGTSCIHLPASIISI 14 SC+P+ S+ L+PK HSM F + +P SIIS+ Sbjct: 195 SCAPYPHSNELHPKIHSMASFLVFYV-IPLSIISV 228
>GRPE_METSS (Q9ZFC7) Protein grpE (HSP-70 cofactor)| Length = 157 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 297 RKVVKDLSVPRRFIMQKLAISMLNFGDELHTEAIIENA 410 R+ +D+ R+F ++K + +L D L ++ENA Sbjct: 55 RRAAEDIDKARKFALEKFSSELLAVKDSLDAALVVENA 92
>HEM6_LEGPL (Q5WX75) Coproporphyrinogen 3 oxidase, aerobic (EC 1.3.3.3)| (Coproporphyrinogen III oxidase, aerobic) (Coproporphyrinogenase) (Coprogen oxidase) Length = 309 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 130 HSTASNSCSPFSSPLYPK 77 H TA N+C PF +YPK Sbjct: 153 HQTALNACLPFGETIYPK 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,045,562 Number of Sequences: 219361 Number of extensions: 1413617 Number of successful extensions: 3765 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3762 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)