Clone Name | bastl22b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TLX2_MOUSE (Q61663) T-cell leukemia homeobox protein 2 (Homeobox... | 29 | 3.7 | 2 | PTPA1_ASPOR (Q2UN27) Serine/threonine-protein phosphatase 2A act... | 28 | 6.4 |
---|
>TLX2_MOUSE (Q61663) T-cell leukemia homeobox protein 2 (Homeobox protein| Hox-11L1) (Homeobox TLX-2) (PMUR10F) Length = 284 Score = 29.3 bits (64), Expect = 3.7 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Frame = +2 Query: 191 SGPDSPPSGGC------LVYGRGVAASAGFEGASDRAPA 289 SGP+ PP GG +G A S+GF GAS APA Sbjct: 26 SGPE-PPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPA 63
>PTPA1_ASPOR (Q2UN27) Serine/threonine-protein phosphatase 2A activator 1 (EC| 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-1) (PPIase PTPA-1) (Rotamase PTPA-1) (Phosphotyrosyl phosphatase activator 1) Length = 478 Score = 28.5 bits (62), Expect = 6.4 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 189 SLGP-TRPRRAVASSTGEGSRPRRASRERATELRRPWSTSTSAPW 320 S GP TRPR+ S+ + +A A++ P ST T+APW Sbjct: 372 SSGPETRPRQVPPSARQDPGPGTKAPWATASQSTPPPSTGTAAPW 416 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.132 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,869,862 Number of Sequences: 219361 Number of extensions: 427462 Number of successful extensions: 1662 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1662 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)