Clone Name | bastl22a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PHOT1_ARATH (O48963) Phototropin-1 (EC 2.7.11.1) (Non-phototropi... | 30 | 1.1 | 2 | NDPA_PSEAE (Q9HXF7) Nucleoid-associated protein ndpA | 29 | 3.2 |
---|
>PHOT1_ARATH (O48963) Phototropin-1 (EC 2.7.11.1) (Non-phototropic hypocotyl| protein 1) (Root phototropism protein 1) Length = 996 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +3 Query: 267 EEPPQRPKQQ-LPRDSRGSLEVFD 335 E+P +P + LPRD+RGSLEVF+ Sbjct: 5 EKPSTKPSSRTLPRDTRGSLEVFN 28
>NDPA_PSEAE (Q9HXF7) Nucleoid-associated protein ndpA| Length = 334 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -1 Query: 131 RPQLFSSSYFIYLLGTGISYEEEEEGLLKRSKAEQLRQQ 15 R + S S+ +LLG+ + Y+EE + L+ R QL+ Q Sbjct: 290 RAEGLSISFEAHLLGSKVEYDEERDMLIIRQLPTQLKDQ 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,482,495 Number of Sequences: 219361 Number of extensions: 300231 Number of successful extensions: 1060 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)