Clone Name | bastl21e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HCN4_RABIT (Q9TV66) Potassium/sodium hyperpolarization-activated... | 29 | 3.7 | 2 | MYCB2_MOUSE (Q7TPH6) Probable ubiquitin ligase protein MYCBP2 (E... | 28 | 8.3 |
---|
>HCN4_RABIT (Q9TV66) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Hyperpolarization-activated cation channel 4) (HAC-4) Length = 1175 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +2 Query: 116 AAG--QSQGAIMASNTGASGWLRGKVKAVTSGDCLLIMGS 229 AAG +S+GA + G RG K+ T+GDC GS Sbjct: 66 AAGGAESRGAALGGAADGEGPARGAAKSSTNGDCRRFRGS 105
>MYCB2_MOUSE (Q7TPH6) Probable ubiquitin ligase protein MYCBP2 (EC 6.3.2.-) (Myc| binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4711 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 114 SGLRLPIRDPGEGVWPAG*SLLS-RPDPDPN 25 +GL + ++DP +G+ P G L+ + DP PN Sbjct: 2393 AGLEVKVKDPPKGMIPPGTQLVKPKADPQPN 2423 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,630,356 Number of Sequences: 219361 Number of extensions: 475684 Number of successful extensions: 1393 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1393 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)