| Clone Name | bastl20h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LECB_PHYAM (Q9AVB0) Lectin-B precursor (PL-B) | 30 | 2.0 | 2 | PSAF_SYNEN (P0A402) Photosystem I reaction center subunit III pr... | 28 | 7.7 | 3 | PSAF_SYNEL (P0A401) Photosystem I reaction center subunit III pr... | 28 | 7.7 | 4 | BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associa... | 28 | 7.7 | 5 | DNAJ_RICPR (Q9ZDY0) Chaperone protein dnaJ | 28 | 7.7 |
|---|
>LECB_PHYAM (Q9AVB0) Lectin-B precursor (PL-B)| Length = 361 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 3/20 (15%) Frame = +1 Query: 64 GRTCI---CCDGWAWAGSNE 114 GRTC+ CC W W GS+E Sbjct: 221 GRTCLNDLCCSEWGWCGSSE 240
>PSAF_SYNEN (P0A402) Photosystem I reaction center subunit III precursor| (PSI-F) Length = 164 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 2 NTAVSPP--QKKVSRPSLLLCGEDELAYAATDG 94 NT P QK+ R S LCGED L + DG Sbjct: 46 NTTADPASGQKRFERYSQALCGEDGLPHLVVDG 78
>PSAF_SYNEL (P0A401) Photosystem I reaction center subunit III precursor| (PSI-F) Length = 164 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 2 NTAVSPP--QKKVSRPSLLLCGEDELAYAATDG 94 NT P QK+ R S LCGED L + DG Sbjct: 46 NTTADPASGQKRFERYSQALCGEDGLPHLVVDG 78
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 172 PPCHFPPPRDTRSRGRSSAIHYSQPMPIRRSI 77 PP H+ PPR S SS H+ +P P+ R + Sbjct: 1514 PPTHYDPPR--ASNAISSDPHFEEPGPMVRGV 1543
>DNAJ_RICPR (Q9ZDY0) Chaperone protein dnaJ| Length = 370 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 64 GRTCICCDGWAWAGSNELQS--FYLENECHAGAENGRVVE 177 G T CD G+ +Q F LE CH NG++++ Sbjct: 157 GETITTCDACGGVGATRIQQGFFTLEQTCHKCQGNGQIIK 196 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,575,034 Number of Sequences: 219361 Number of extensions: 770048 Number of successful extensions: 2959 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2953 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)