Clone Name | bastl20f05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COIA1_MOUSE (P39061) Collagen alpha-1(XVIII) chain precursor [Co... | 28 | 8.5 | 2 | PANB_EMENI (Q9Y7B6) 3-methyl-2-oxobutanoate hydroxymethyltransfe... | 28 | 8.5 |
---|
>COIA1_MOUSE (P39061) Collagen alpha-1(XVIII) chain precursor [Contains:| Endostatin] Length = 1774 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 106 HTQMRPCLAWSSLVFLPPLHSTTDGPPSPSP 14 HT P LAW + L P S GPP P P Sbjct: 414 HTNCHPFLAWFFCLLLAP--SCGPGPPPPLP 442
>PANB_EMENI (Q9Y7B6) 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC| 2.1.2.11) (Ketopantoate hydroxymethyltransferase) Length = 349 Score = 27.7 bits (60), Expect = 8.5 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 106 HTQMRPCLAWSSLVFLPPLHSTTDGPPSPSPCFV 5 H P L SS+ LP LHST PSPC + Sbjct: 15 HRPANPALPTSSI--LPVLHSTNVATRVPSPCAI 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,516,005 Number of Sequences: 219361 Number of extensions: 323022 Number of successful extensions: 1487 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1487 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)