Clone Name | bastl20f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RDRP_TMOB (P90211) RNA-directed RNA polymerase (EC 2.7.7.48) (18... | 30 | 2.7 | 2 | Y1536_PSEAE (Q9I3H7) Hypothetical UPF0167 protein PA1536 | 29 | 5.9 |
---|
>RDRP_TMOB (P90211) RNA-directed RNA polymerase (EC 2.7.7.48) (183 kDa| protein) [Contains: Methyltransferase/RNA helicase (MT/HEL) (126 kDa protein)] Length = 1616 Score = 30.4 bits (67), Expect = 2.7 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 7/65 (10%) Frame = +2 Query: 317 CRASATSGGSRSYAL-------VPADELSRALARQNSSLALHNKHSFAEDSAGAYPLVLR 475 C ++ S G R YA+ +PADEL AL R+N L+ FAE+ L+L Sbjct: 186 CESNRYSSGGRVYAISLHSLYDIPADELGAALLRKNVH-TLYAAFHFAEE------LLLE 238 Query: 476 ISVRE 490 +S E Sbjct: 239 VSTVE 243
>Y1536_PSEAE (Q9I3H7) Hypothetical UPF0167 protein PA1536| Length = 179 Score = 29.3 bits (64), Expect = 5.9 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 225 PRRRPHPHIMASGFSTASSTQISCCASTAG 314 P R HP +ASG AS+T CC G Sbjct: 6 PHFRYHPEPLASGSIEASATTCQCCGKARG 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,070,224 Number of Sequences: 219361 Number of extensions: 606822 Number of successful extensions: 1829 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1828 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)