Clone Name | bastl20e06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 45 | 1e-04 | 2 | YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II | 30 | 3.4 |
---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 44.7 bits (104), Expect = 1e-04 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = +3 Query: 357 ADDENPEDFIDPETPSGQKKSLAPQMA 437 A +ENPEDF+DPETP G++K L+ QMA Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMA 137
>YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II| Length = 456 Score = 29.6 bits (65), Expect = 3.4 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -1 Query: 123 EIGWYGWSRRRGRAPALAWTLRSTARAECP*QVRVLRNFLS 1 EIG G + + AP+ W LR+ R EC +R R ++S Sbjct: 392 EIGDIGAQQWKTLAPSERWILRTNIRKECTYDIRYKRPYVS 432 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,375,223 Number of Sequences: 219361 Number of extensions: 249014 Number of successful extensions: 805 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)