Clone Name | bastl20b12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PARP4_HUMAN (Q9UKK3) Poly [ADP-ribose] polymerase 4 (EC 2.4.2.30... | 31 | 1.7 | 2 | ITB4_HUMAN (P16144) Integrin beta-4 precursor (GP150) (CD104 ant... | 29 | 6.6 | 3 | HIPK2_MOUSE (Q9QZR5) Homeodomain-interacting protein kinase 2 (E... | 28 | 8.6 |
---|
>PARP4_HUMAN (Q9UKK3) Poly [ADP-ribose] polymerase 4 (EC 2.4.2.30) (PARP-4) (Vault| poly(ADP-ribose) polymerase) (VPARP) (193-kDa vault protein) (PARP-related/IalphaI-related H5/proline-rich) (PH5P) Length = 1724 Score = 30.8 bits (68), Expect = 1.7 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 6/55 (10%) Frame = -2 Query: 344 PIITPAVGSFLLPV----RPGSMVGRSWRGC*VFGRR--QNQIDGSMMVRMPNPG 198 PI+ PAVGS+L P P S+ S+R FG Q D S + P PG Sbjct: 1317 PILAPAVGSYLTPTTRAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPG 1371
>ITB4_HUMAN (P16144) Integrin beta-4 precursor (GP150) (CD104 antigen)| Length = 1822 Score = 28.9 bits (63), Expect = 6.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 82 FFACLLACCMLVPCCGRG 29 + AC AC L+PCC RG Sbjct: 735 YCACCKACLALLPCCNRG 752
>HIPK2_MOUSE (Q9QZR5) Homeodomain-interacting protein kinase 2 (EC 2.7.11.1)| (Nuclear body-associated kinase 1) (Sialophorin tail-associated nuclear serine/threonine-protein kinase) Length = 1196 Score = 28.5 bits (62), Expect = 8.6 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 353 HSVPIITPAVGSFLLPVRPGSMVGRSWRG 267 ++VPI+T A G+ L ++PG + ++W G Sbjct: 681 NAVPIVTQAPGAQPLQIQPGLLAQQAWPG 709 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,006,885 Number of Sequences: 219361 Number of extensions: 978434 Number of successful extensions: 2567 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2564 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)