Clone Name | bastl19g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALA2_ARATH (P98205) Putative phospholipid-transporting ATPase 2 ... | 35 | 0.052 | 2 | EGFL8_MOUSE (Q6GUQ1) EGF-like domain-containing protein 8 precur... | 29 | 3.7 | 3 | YRM8_CAEEL (Q09417) Hypothetical WD-repeat protein R06F6.8 | 28 | 8.3 |
---|
>ALA2_ARATH (P98205) Putative phospholipid-transporting ATPase 2 (EC 3.6.3.1)| (Aminophospholipid flippase 2) Length = 1107 Score = 35.4 bits (80), Expect = 0.052 Identities = 16/26 (61%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = +1 Query: 340 MQRFVYIND-ESCRDSYCDNRVSNTK 414 M+RFVYIND E+ ++ CDNR+SN K Sbjct: 1 MKRFVYINDDEASKELCCDNRISNRK 26
>EGFL8_MOUSE (Q6GUQ1) EGF-like domain-containing protein 8 precursor (Epidermal| growth factor-like protein 8) (Multiple EGF-like domain protein 8) Length = 293 Score = 29.3 bits (64), Expect = 3.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 135 EVRVQVARGCRWVKESGAWLSEKTPLVPSRLRSLQ 31 E+R ++ + +W K++GAW+ P+ P LR Q Sbjct: 218 ELRGRLEKLEQWAKQAGAWVRAVLPMPPEELRPEQ 252
>YRM8_CAEEL (Q09417) Hypothetical WD-repeat protein R06F6.8| Length = 1470 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 9 FLRAPPFSGDFGVSRAPTASSPRA 80 F R PP S +SR PT SSP A Sbjct: 975 FFRTPPPSAKTSLSRRPTVSSPSA 998 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,352,204 Number of Sequences: 219361 Number of extensions: 739310 Number of successful extensions: 2077 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2076 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)