Clone Name | bastl19c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRUB_SYMTH (Q67P83) tRNA pseudouridine synthase B (EC 5.4.99.-) ... | 29 | 7.5 | 2 | VGLB_SHV1 (Q04464) Glycoprotein B precursor | 29 | 7.5 | 3 | PME3_CAEEL (Q867X0) Poly(ADP-ribose) glycohydrolase pme-3 (EC 3.... | 29 | 7.5 |
---|
>TRUB_SYMTH (Q67P83) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 299 Score = 28.9 bits (63), Expect = 7.5 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 7/55 (12%) Frame = -3 Query: 230 LLHTKLNPYALSRVQIFDVLAA-------QMAALGSPPRVKCRGCDATAVAIGVA 87 L+ T+ P+ L++ + LAA AALG PRV G A V GVA Sbjct: 205 LVRTRSGPFVLAQAATLEELAAGKARLLPPAAALGDMPRVTVSGRAAARVLHGVA 259
>VGLB_SHV1 (Q04464) Glycoprotein B precursor| Length = 920 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 441 INRHTTAIILRSRWNTANPPSS 376 I+RH T ++LR R NTA PPSS Sbjct: 886 ISRHLTDMVLRKR-NTARPPSS 906
>PME3_CAEEL (Q867X0) Poly(ADP-ribose) glycohydrolase pme-3 (EC 3.2.1.143) (Poly| ADP-ribose metabolism enzyme 3) Length = 781 Score = 28.9 bits (63), Expect = 7.5 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +1 Query: 97 MATAVASQPRHFTLGGEPR-AAICAASTSKICTLDKAYGFSFVCRSVVDLRSKKFHSQIS 273 +A VA +P HF GEP AA C ++ D G F + L K F + Sbjct: 697 IAAGVADRPLHFCSFGEPELAAKCKKIIERMKQKDVTLGMLFSMINNTGLPHKHFEFYVF 756 Query: 274 KR-KCYLTSS 300 R YL+SS Sbjct: 757 DRISTYLSSS 766 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.129 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,550,714 Number of Sequences: 219361 Number of extensions: 1165611 Number of successful extensions: 2697 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2697 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)