| Clone Name | bastl19a05 |
|---|---|
| Clone Library Name | barley_pub |
>CESA1_ARATH (O48946) Cellulose synthase A catalytic subunit 1 [UDP-forming] (EC| 2.4.1.12) (AtCesA-1) (Radially swollen protein 1) (AtRSW1) Length = 1081 Score = 51.6 bits (122), Expect = 4e-07 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +1 Query: 244 MAANRGMVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTVG 390 M A+ G+VAGS+ RNE V IR++ D K +K GQ CQICGD VG Sbjct: 1 MEASAGLVAGSYRRNELVRIRHESDGGT--KPLKNMNGQICQICGDDVG 47
>CESA7_ARATH (Q9SWW6) Cellulose synthase A catalytic subunit 7 [UDP-forming] (EC| 2.4.1.12) (AtCesA-7) (Irregular xylem protein 3) (AtIRX3) Length = 1026 Score = 51.6 bits (122), Expect = 4e-07 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = +1 Query: 244 MAANRGMVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTVG 390 M A+ G+VAGSHNRNE V+I N + K +K GQ C+ICGD +G Sbjct: 1 MEASAGLVAGSHNRNELVVIHNHEEP----KPLKNLDGQFCEICGDQIG 45
>CESA5_ARATH (Q8L778) Cellulose synthase A catalytic subunit 5 [UDP-forming] (EC| 2.4.1.12) (AtCesA-5) Length = 1069 Score = 46.6 bits (109), Expect = 1e-05 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = +1 Query: 262 MVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTV 387 ++AGSHNRNEFV+I + D A + V+ GQ CQICGD + Sbjct: 7 LIAGSHNRNEFVLI--NADESARIRSVEELSGQTCQICGDEI 46
>CESA2_ARATH (O48947) Cellulose synthase A catalytic subunit 2 [UDP-forming] (EC| 2.4.1.12) (AtCesA-2) (Ath-A) Length = 1084 Score = 46.6 bits (109), Expect = 1e-05 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = +1 Query: 262 MVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTV 387 ++AGSHNRNEFV+I + D A + V+ GQ CQICGD + Sbjct: 7 LIAGSHNRNEFVLI--NADESARIRSVQELSGQTCQICGDEI 46
>CESA6_ARATH (Q94JQ6) Cellulose synthase A catalytic subunit 6 [UDP-forming] (EC| 2.4.1.12) (AtCesA-6) (Isoxaben resistant protein 2) (Protein PROCUSTE1) (Protein Quill) (AraxCelA) Length = 1084 Score = 43.9 bits (102), Expect = 9e-05 Identities = 21/42 (50%), Positives = 28/42 (66%) Frame = +1 Query: 262 MVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTV 387 ++AGSHNRNEFV+I D +A + V+ GQ CQIC D + Sbjct: 7 LIAGSHNRNEFVLINADENARI--RSVQELSGQTCQICRDEI 46
>CESAA_ARATH (Q9SKJ5) Probable cellulose synthase A catalytic subunit 10| [UDP-forming] (EC 2.4.1.12) (AtCesA-10) (AtCesA-13) Length = 1065 Score = 43.9 bits (102), Expect = 9e-05 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = +1 Query: 262 MVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTVG 390 MVAGS+ R EFV R+D D K +K GQ CQICGD VG Sbjct: 1 MVAGSYRRYEFVRNRDDSDDGL--KPLKDLNGQICQICGDDVG 41
>CESA9_ARATH (Q9SJ22) Probable cellulose synthase A catalytic subunit 9| [UDP-forming] (EC 2.4.1.12) (AtCesA-9) Length = 1088 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +1 Query: 262 MVAGSHNRNEFVMIRNDGDAPAPGKEVKGAGGQGCQICGDTV 387 ++AGSHNRNEFV+I D A + + GQ C+IC D + Sbjct: 7 LIAGSHNRNEFVLINADDTARI--RSAEELSGQTCKICRDEI 46
>PTN23_RAT (O88902) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) (His-domain-containing protein tyrosine phosphatase) (HD-PTP) (Protein tyrosine phosphatase TD14) (PTP-TD14) (Fragment) Length = 1499 Score = 30.8 bits (68), Expect = 0.82 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = -3 Query: 389 PTVSPHIWQP*PPAPFTSLPGAGASPSLRIMTNSLRLCDPATIPRLAAIFRSPAALTPH 213 P+ +P I P PP PFT PG P T P T+P + P+ PH Sbjct: 849 PSQAPGILTPPPPYPFTPQPGVLGQPPPTRHTQLYPGPPPDTLPPHSGALPFPSPGPPH 907
>GSCR1_HUMAN (Q9NZM4) Glioma tumor suppressor candidate region gene 1 protein| Length = 1509 Score = 27.7 bits (60), Expect(2) = 1.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 279 VRPRDHPPVGRHLSLPRRPHTPPAAVTKA 193 +RP+ PP G LP PH PP++ + A Sbjct: 811 LRPQSQPPEG---PLPPAPHLPPSSTSSA 836 Score = 20.8 bits (42), Expect(2) = 1.4 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = -3 Query: 380 SPHIWQP*PPAPFTSLPGAGASPSLRIMTNSLRLCDPATIP 258 SPH+ P P P + P S S L C P P Sbjct: 737 SPHLPSPHPTRPPSRPPSRPQSVSRPPSEPPLHPCPPPQAP 777
>ACCN3_HUMAN (Q9UHC3) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (hASIC3) (Testis sodium channel 1) (hTNaC1) Length = 531 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 246 HLSLPRRPHTPPAAVTK 196 HLSL RP TPP AVTK Sbjct: 500 HLSLGPRPPTPPCAVTK 516
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.5 bits (62), Expect = 4.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 279 VRPRDHPPVGRHLSLPRRPHTP 214 + P+ PP G+H++ PR P P Sbjct: 2282 IAPQSRPPEGKHITTPREPLPP 2303
>CSKI2_MOUSE (Q8VHK1) Caskin-2| Length = 1201 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 362 P*PPAPFTSLPGAGASPS-LRIMTNSLRLCDPATIPRL 252 P PPA +PGAG +P + + L P PRL Sbjct: 1085 PAPPAALLKVPGAGTAPKPVSVACTQLAFSGPKLAPRL 1122
>YTUB_ENTAG (Q47826) Hypothetical protein in tutB 3'region (Fragment)| Length = 204 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 270 RDHPPVGRHLSLPRRPHTPPAAVTKA 193 RDHP + L+ P +PH+ P + +A Sbjct: 140 RDHPLIVADLAQPHQPHSAPGIIVEA 165
>ACCN3_MOUSE (Q6X1Y6) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (Dorsal root ASIC) (DRASIC) Length = 530 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -2 Query: 270 RDHPPVGRHLSLPRRPHTPPAAVTK 196 R H P HLSL RP T P+AVTK Sbjct: 494 RTHVP---HLSLGPRPPTAPSAVTK 515
>SNF1_CANTR (O94168) Carbon catabolite derepressing protein kinase (EC| 2.7.11.1) Length = 619 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -3 Query: 353 PAPFTSLPGAGASPSLRIMTNSLRLCDPATIPRLAAIFRSPAALTP 216 P P +S P G++ S + SL AT+P L+ + S A+ P Sbjct: 406 PPPSSSFPNPGSTSSAPGVQQSLTYQTLATVPDLSTLPNSTIAILP 451
>SI1L3_HUMAN (O60292) Signal-induced proliferation-associated 1-like protein 3| (SPA-1-like protein 3) Length = 1781 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 318 VAVVADHDELIAIVRPRDHPPVGRHLSLPRRPHTPPAAVT 199 V++ + +D ++ P H PV HLSL R P TP T Sbjct: 1666 VSLFSLNDPALSPDIPPAHSPVHSHLSLERGPPTPRTTPT 1705 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,756,586 Number of Sequences: 219361 Number of extensions: 646346 Number of successful extensions: 2307 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2297 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)