Clone Name | bastl18f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TSP4_RAT (P49744) Thrombospondin-4 precursor | 28 | 4.0 | 2 | PCB_PRODI (Q6Q972) Chlorophyll a/b light-harvesting protein pcb | 28 | 5.2 |
---|
>TSP4_RAT (P49744) Thrombospondin-4 precursor| Length = 980 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -2 Query: 398 SPNLEPFVALRSSSPPKATTRRRDQRLGGQCDSSPAFLGAR 276 SP V + +PP TRR CDSSP F G R Sbjct: 286 SPTPNTLVPIAPPAPPTRPTRR--------CDSSPCFRGVR 318
>PCB_PRODI (Q6Q972) Chlorophyll a/b light-harvesting protein pcb| Length = 350 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 310 CPPSRWSRRLVVAFGGELLRKATKG 384 CPP +W++RL++ G LL A G Sbjct: 225 CPPFKWAQRLIIYSGEGLLAYALGG 249 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,746,953 Number of Sequences: 219361 Number of extensions: 456684 Number of successful extensions: 1358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1358 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)