Clone Name | bastl18c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 39 | 0.005 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 38 | 0.007 |
---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 38.5 bits (88), Expect = 0.005 Identities = 23/45 (51%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +1 Query: 52 MLPRKREIVASEVENQQKKARPXXXXXX-----XXXXGRPTEIDE 171 MLPRKREIVA EVE+ QKK R GR EIDE Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEATREEGDAAMAGRGNEIDE 45
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 38.1 bits (87), Expect = 0.007 Identities = 23/45 (51%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +1 Query: 52 MLPRKREIVASEVENQQKKARP-----XXXXXXXXXXGRPTEIDE 171 MLPRKREIVA EVE+ QKK R GR EIDE Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEVTREEGDAAMAGRGNEIDE 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,518,868 Number of Sequences: 219361 Number of extensions: 109426 Number of successful extensions: 277 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 277 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)