Clone Name | bastl18c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POLG_POL2L (P06210) Genome polyprotein [Contains: Coat protein V... | 28 | 5.5 | 2 | POLG_POL2W (P23069) Genome polyprotein [Contains: Coat protein V... | 28 | 5.5 |
---|
>POLG_POL2L (P06210) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2206 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/33 (33%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +1 Query: 229 AEFDVKAITISANSWIDA--GHAVNQLYDLLYM 321 + FD++ + +++ DA GHA+NQ+Y ++Y+ Sbjct: 705 SRFDMEFTFVVTSNYTDANNGHALNQVYQIMYI 737
>POLG_POL2W (P23069) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2204 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/33 (33%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +1 Query: 229 AEFDVKAITISANSWIDA--GHAVNQLYDLLYM 321 + FD++ + +++ DA GHA+NQ+Y ++Y+ Sbjct: 705 SRFDMEFTFVVTSNYTDANNGHALNQVYQIMYI 737 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,063,258 Number of Sequences: 219361 Number of extensions: 420062 Number of successful extensions: 1227 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1227 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)