Clone Name | bastl18a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y4837_ARATH (P58223) Probable nucleic acid binding protein At4g1... | 29 | 5.9 | 2 | SET1_YEAST (P38827) Histone-lysine N-methyltransferase, H3 lysin... | 28 | 7.7 |
---|
>Y4837_ARATH (P58223) Probable nucleic acid binding protein At4g18375| Length = 606 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 300 KKRTRFNSDDGKRKRLNYRQDDGPMSSQPIETVYRILCPGNKIGGIL 440 KKR + ++ + R R+ ++ VYRILCP + +GG++ Sbjct: 5 KKRKQIQRNNSESNRNQKRRISHDKINRDELVVYRILCPIDVVGGVI 51
>SET1_YEAST (P38827) Histone-lysine N-methyltransferase, H3 lysine-4 specific| (EC 2.1.1.43) (COMPASS component SET1) (SET domain protein 1) Length = 1080 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 270 NSRRHNPSTSKKRTRFNSDDGKRKRLNYRQDDGPMSSQPIET 395 +S + S +R R+N +DG R+R N DD P SS T Sbjct: 36 HSHQQYSSQYNQRRRYNHNDGTRRRYN---DDRPHSSNNAST 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,913,015 Number of Sequences: 219361 Number of extensions: 629665 Number of successful extensions: 1324 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1324 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)