Clone Name | bastl17h08 |
---|---|
Clone Library Name | barley_pub |
>NCL1_YEAST (P38205) Putative methyltransferase NCL1 (EC 2.1.1.-)| Length = 684 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +3 Query: 171 RENVWKDNPRRPPASAGEGGEGNGWQPFATENLAFEAYYKGQXIVPEEEWDAFMSMLRKP 350 R+N K N + A + N W EN +E YYK + PE++W+ F + P Sbjct: 4 RKNFKKGNKKTFGARDDSRAQKN-WSELVKENEKWEKYYKTLALFPEDQWEEFKKTCQAP 62 Query: 351 LP 356 LP Sbjct: 63 LP 64
>PABS_STRGR (P32483) Para-aminobenzoate synthase (EC 6.3.5.8) (P-aminobenzoic| acid synthase) (PABA synthase) Length = 723 Score = 31.6 bits (70), Expect = 0.50 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 199 GALPPP-PAKEARATAGSPSPRRTWPSRLTTR 291 G LPPP PA+E +AT G+P R L TR Sbjct: 204 GTLPPPAPARETKATTGTPRRLRVIAKSLPTR 235
>ICP34_HHV1F (P08353) Infected cell protein ICP34.5 (Neurovirulence factor| ICP34.5) Length = 263 Score = 31.2 bits (69), Expect = 0.65 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPRRTWP 273 P + PP PA EAR TA +P PR P Sbjct: 83 PDSPPPEPAPEARPTAAAPRPRSPPP 108
>ICP34_HHV1N (P37319) Infected cell protein ICP34.5 (Neurovirulence factor| ICP34.5) Length = 245 Score = 31.2 bits (69), Expect = 0.65 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPRRTWP 273 P + PP PA EAR TA +P PR P Sbjct: 77 PDSPPPEPAPEARPTAAAPRPRSPPP 102
>ICP34_HHV1D (P37318) Infected cell protein ICP34.5 (Neurovirulence factor| ICP34.5) Length = 252 Score = 31.2 bits (69), Expect = 0.65 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPRRTWP 273 P + PP PA EAR TA +P PR P Sbjct: 84 PDSPPPEPAPEARPTAAAPRPRSPPP 109
>BARH1_DROAN (P22544) Homeobox protein B-H1 (Homeobox BarH1 protein)| Length = 606 Score = 30.8 bits (68), Expect = 0.85 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +1 Query: 208 PPPPAKEARATAGSPSP 258 PPPP+ A AT GSPSP Sbjct: 518 PPPPSSAAAATGGSPSP 534
>RL1_HHV11 (O12396) Neurovirulence factor RL1 (Neurovirulence factor ICP34.5)| Length = 248 Score = 30.8 bits (68), Expect = 0.85 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPR 261 P + PP PA EAR TA +P PR Sbjct: 83 PDSPPPEPAPEARPTAAAPRPR 104
>EDS5_ARATH (Q945F0) Enhanced disease susceptibility 5 (Eds5) (Salicylic acid| induction deficient 1) (Sid1) Length = 543 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 323 IPLFLRNNXLPLVVSLEGQVLRGEGLPAVA 234 IP F+ + LP+ VSLEG +L G L V+ Sbjct: 445 IPFFMALSALPMTVSLEGTLLAGRDLKFVS 474
>CLC14_HUMAN (Q86T13) C-type lectin domain family 14 member A precursor| (Epidermal growth factor receptor 5) (EGFR-5) Length = 490 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 217 PAKEARATAGSPSPRRTWPSRL 282 P + ATA SP P+RTWP R+ Sbjct: 302 PTRRPPATATSPVPQRTWPIRV 323
>NIFJ_ANASP (Q06879) Pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-)| Length = 1199 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 259 VAKGCQPLPSPPSPAEA--GGRLGLSFQTFSRSCLK 158 V K P+PSP SP GGR GLS + F+ + +K Sbjct: 353 VNKNNSPVPSPQSPVPKIIGGRYGLSSKEFTPAMVK 388
>DYR1B_MOUSE (Q9Z188) Dual specificity tyrosine-phosphorylation-regulated kinase| 1B (EC 2.7.12.1) Length = 589 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 280 ASKARFSVAKGCQPLPSPPSPAEAGGRLGL 191 AS R + G PLP P PA G RLGL Sbjct: 549 ASALRTRMTGGRPPLPPPDDPATLGPRLGL 578
>CHEB3_PSEU2 (Q4ZQV7) Chemotaxis response regulator protein-glutamate| methylesterase 3 (EC 3.1.1.61) Length = 386 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 202 ALPPPPAKEARATAGSPSPRRTWPSRLTT 288 A P P +RA+A +P+P R PSR T Sbjct: 147 AAPAPSTLSSRASAPAPAPARAVPSRTAT 175
>ATBF1_HUMAN (Q15911) Alpha-fetoprotein enhancer-binding protein (AT motif-binding| factor) (AT-binding transcription factor 1) Length = 3703 Score = 28.9 bits (63), Expect = 3.2 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 7/58 (12%) Frame = +1 Query: 208 PPPPAKEARATAGSPSPRRTWPSRLTTRGSXL-------FLRKSGMPS*ACSGSHCQP 360 PPPP+ A ++A + R++WP ++ +R S S + S +CS S QP Sbjct: 3597 PPPPSAAAPSSASPHASRKSWP-QVVSRASAAKPPSFPPLSSSSTVTSSSCSTSGVQP 3653
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 280 ASKARFSVAKGCQPLPSPPSPA 215 A A + + KG P PSPPSPA Sbjct: 367 AMMASYPIKKGPNPKPSPPSPA 388
>GCYA2_HUMAN (P33402) Guanylate cyclase soluble subunit alpha-2 (EC 4.6.1.2)| (GCS-alpha-2) Length = 732 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPRRTWPSRLTTRGSXLFLRK 315 PG L P PA A A A +P+P + + T G+ R+ Sbjct: 43 PGPLEPSPAAAAAAAAPAPTPAASAAAAAATAGARRVQRR 82
>EL5_ORYSA (Q9LRB7) E3 ubiquitin ligase EL5 (EC 6.3.2.-)| Length = 325 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +3 Query: 186 KDNPRRPPASAGEGGEGNGWQPFATENLAFEAYYKGQXIVPEEE 317 + PRR S G+GG G G P +L Y + +E Sbjct: 80 RPRPRRRSGSGGDGGTGGGVDPEVLRSLPVTVYSRSTAAAAAKE 123
>ICP34_HHV11 (P36313) Infected cell protein ICP34.5 (Neurovirulence factor| ICP34.5) Length = 248 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPR 261 P + PP A EAR TA +P PR Sbjct: 83 PDSPPPESAPEARPTAAAPRPR 104
>ANTR1_HUMAN (Q9H6X2) Anthrax toxin receptor 1 precursor (Tumor endothelial| marker 8) Length = 564 Score = 27.7 bits (60), Expect = 7.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 205 LPPPPAKEARATAGSPSPRRTWPS 276 +PPPPA+E+ P++ WP+ Sbjct: 354 VPPPPAEESEEEDDDGLPKKKWPT 377
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSP 258 PG +PP P + R AG+P P Sbjct: 1323 PGQVPPSPQQHVRPAAGAPYP 1343
>DAS_PICAN (P06834) Dihydroxyacetone synthase (EC 2.2.1.3) (DHAS)| (Formaldehyde transketolase) (Glycerone synthase) Length = 710 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 171 RENVWKDNPRRPPASAGEGGEGNGWQPFATENLAFEAYYKGQXIVPEEEWDAF 329 R +V + + R+ P +G GW+ +AT + Y G+ + PE ++ F Sbjct: 617 RRSVLRKDGRQVPTVVVDGHVAFGWERYATASYCMNTY--GKSLPPEVIYEYF 667
>ZN469_HUMAN (Q96JG9) Zinc finger protein 469 (Fragment)| Length = 2469 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -2 Query: 277 SKARFSVAKGCQPLPSPPSPAEAGGRLGLSFQTFSRSCLK*RRCER 140 S+A S+ + +P PSPPSP L L+ SRS + R ER Sbjct: 558 SRAAMSLQEEAEPTPSPPSPNRESLALALT-AAHSRSGSEGRTPER 602
>XYLG_PSEPU (P23105) 2-hydroxymuconic semialdehyde dehydrogenase (EC 1.2.1.-)| (HMSD) Length = 486 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -1 Query: 293 PLVVSLEGQVLRGEGLPAVALASFAGGGGRAPGVVL---PDV 177 PL +L G+V++ G+PA G GG + G L PDV Sbjct: 184 PLTATLLGEVMQAAGVPAGVYNVVHGFGGDSAGAFLTEHPDV 225
>DYR1B_HUMAN (Q9Y463) Dual specificity tyrosine-phosphorylation-regulated kinase| 1B (EC 2.7.12.1) (Mirk protein kinase) (Minibrain-related kinase) Length = 629 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 280 ASKARFSVAKGCQPLPSPPSPAEAGGRLGL 191 AS R + G PLP P PA G LGL Sbjct: 589 ASALRTRMTGGRPPLPPPDDPATLGPHLGL 618
>PROL1_HUMAN (Q99935) Proline-rich protein 1 precursor (PRL1) (Basic| proline-rich lacrimal protein) Length = 201 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPRRTWPSRLTTRGSXLFLRKSGMPS 330 PG LPPPP R SP P + SRL + S F+ PS Sbjct: 31 PGQLPPPPLYRPRWVPPSPPP--PYDSRLNSPLSLPFVPGRVPPS 73
>LAP4_MOUSE (Q80U72) LAP4 protein (Scribble homolog protein)| Length = 1612 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 247 CQPLPSPPSPAEAGGRL 197 C+P PSPPSP+E RL Sbjct: 498 CKPDPSPPSPSEEEKRL 514
>HAND1_RABIT (P57100) Heart- and neural crest derivatives-expressed protein 1| (Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (eHAND) Length = 215 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 196 PGALPPPPAKEARATAGSPSPRRTWPSRLTTRGSXLFLRKSGMP 327 P PPP A A AT G + P RL G L RK P Sbjct: 57 PTGGPPPTAAAAAATYGPDTRPGQSPGRLEALGGRLGRRKGSGP 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,380,054 Number of Sequences: 219361 Number of extensions: 704108 Number of successful extensions: 4675 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4639 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)