Clone Name | bastl17f07 |
---|---|
Clone Library Name | barley_pub |
>PHC3_MOUSE (Q8CHP6) Polyhomeotic-like protein 3| Length = 981 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = -1 Query: 356 RVPHHQLLISRYHSLVL-----TRSRPHPPQSHCLPVPKN 252 +V HHQLL+ + + + S+ PP HC+P+P + Sbjct: 316 KVSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNH 355
>MCM7_XENLA (Q91876) DNA replication licensing factor MCM7 (CDC47 homolog)| (x.MCM7) Length = 720 Score = 30.8 bits (68), Expect = 0.82 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +2 Query: 146 NSPFSAGSEPHPLHGRDSSLKTVEGNLQAAAAMASRF 256 N+ S + +P +GR + KTVE N+Q AA+ SRF Sbjct: 478 NARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRF 514
>SYH_PORPU (P51348) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 430 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +3 Query: 207 RQLKVIYKQQQPWRLVFGD----RETVTLRRMWTRSSQNKGVIARNQKL 341 +QLK +K++ L+ GD +ET+T++ M+T+ +N +I K+ Sbjct: 366 KQLKQAHKKRAIACLILGDNEIQQETITIKWMYTQEQENMSIIEFKNKI 414
>RT23_SCHPO (Q9UR07) Retrotransposable element Tf2 155 kDa protein type 3| Length = 1333 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 341 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 240 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>RT22_SCHPO (Q9C0R2) Retrotransposable element Tf2 155 kDa protein type 2| Length = 1333 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 341 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 240 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>RT21_SCHPO (Q05654) Retrotransposable element Tf2 155 kDa protein type 1| Length = 1333 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 341 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 240 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 16/48 (33%) Frame = -1 Query: 350 PHHQLLISRY------HSLVLTRSRPHPPQS----------HCLPVPK 255 PH L +S+ HSL++TR PH P S +CLP+P+ Sbjct: 227 PHLNLSVSKLESWGPVHSLLITRGLPHLPSSEKQQVSFHIPNCLPLPE 274
>HEMA_CVMA5 (P31615) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 428 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -3 Query: 258 QKRDAMAAAACKLPSTVFKLESRPWSG*GSDPAENGE 148 ++ D M AAAC+LP F+ S +SG G+ A +G+ Sbjct: 309 RQSDNMTAAACQLPYCFFRNTSANYSG-GTHDAHHGD 344
>TID_DROVI (Q24331) Protein tumorous imaginal discs, mitochondrial precursor| (Protein lethal(2)tumorous imaginal discs) (TID58) Length = 529 Score = 28.1 bits (61), Expect = 5.3 Identities = 24/82 (29%), Positives = 29/82 (35%), Gaps = 11/82 (13%) Frame = +2 Query: 173 PHPLHG----RDSSLKTVEG--NLQAAAAMASRFWGQGXXXXXXXXXXXXXXQGSDSEKS 334 P +HG +D S K G + A A R G +G SEKS Sbjct: 442 PGQIHGMAQRKDGSKKATAGASETKTDAQPAGRTADSGSQGTSRAGAETESAKGQQSEKS 501 Query: 335 EAG-----DGGRDGSKNRYLNK 385 E GG GS +LNK Sbjct: 502 ETRRKDQQTGGESGSGGGFLNK 523
>TERM_ADE40 (P48313) DNA terminal protein (Bellett protein) (pTP protein)| Length = 646 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +1 Query: 49 ASVLHAAGPSTPSIH--VRCQPLSARPHPSTPP 141 AS L A P +H V PL A PHP PP Sbjct: 606 ASQLRAQHQPLPELHADVPLPPLQANPHPPLPP 638
>YT32_STRFR (P20185) Hypothetical 32.6 kDa protein in transposon Tn4556| Length = 305 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 61 HAAGPSTPSIHVRCQPLSARPHPSTPP 141 H AGPS S+H + L RP PP Sbjct: 111 HLAGPSAVSVHDQADVLGQRPRCRLPP 137
>PHC3_HUMAN (Q8NDX5) Polyhomeotic-like protein 3 (hPH3) (Homolog of| polyhomeotic 3) (Early development regulatory protein 3) Length = 983 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = -1 Query: 356 RVPHHQLLISRYHS----LVLTRSRPHPPQS-HCLPVPKNETP 243 +V HHQL++ + + L S PP S HC+P+ + P Sbjct: 319 KVSHHQLILQQQQQQIQPITLQNSTQDPPPSQHCIPLQNHGLP 361
>HRG_RABIT (Q28640) Histidine-rich glycoprotein precursor| (Histidine-proline-rich glycoprotein) (HPRG) (Fragment) Length = 526 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 362 THRVPHHQLLISRYHSLVLTRSRPHPPQSH 273 THR PHH++ ++ H PH P H Sbjct: 312 THRFPHHRISVNIIHRPPPHGHHPHGPPPH 341
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 24.3 bits (51), Expect(2) = 6.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 87 HPRPLSAAERAAAPVYSAAPILRSP 161 HP P + A+ P+YS +P ++ P Sbjct: 177 HPPPPTYAQPPPTPIYSPSPQVQPP 201 Score = 21.9 bits (45), Expect(2) = 6.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 62 TPPVPQHPPS 91 TPP QHPPS Sbjct: 156 TPPRGQHPPS 165
>PALH_NEUCR (Q7RY98) pH-response regulator protein palH/rim-21| Length = 778 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +2 Query: 314 GSDSEKSEAGDGGRDG 361 GSDS+ +E+G GG+DG Sbjct: 411 GSDSQDTESGGGGKDG 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,890,918 Number of Sequences: 219361 Number of extensions: 783599 Number of successful extensions: 2809 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2808 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)