Clone Name | bastl17e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II | 28 | 7.4 |
---|
>YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II| Length = 456 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 121 EIGWYGWSRRRGRAPALAWTLRSTARAECP*QVRVLRNF 5 EIG G + + AP+ W LR+ R EC +R R + Sbjct: 392 EIGDIGAQQWKTLAPSERWILRTNIRKECTYDIRYKRPY 430 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.122 0.336 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,236,320 Number of Sequences: 219361 Number of extensions: 147543 Number of successful extensions: 405 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)