Clone Name | bastl17d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-ass... | 28 | 6.9 | 2 | COBA1_MOUSE (Q61245) Collagen alpha-1(XI) chain precursor | 27 | 9.0 |
---|
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 148 LLLLRPSIKDCLSPLQRGVPQGTRTLATALI*QRRVHTGQEQGPIPC 288 L + P + D PL+ VP GT+ + +L + QE+ P+PC Sbjct: 1098 LASVSPGLGDTSFPLRHPVPHGTQDFSASLSIEMS-KGPQEEPPVPC 1143
>COBA1_MOUSE (Q61245) Collagen alpha-1(XI) chain precursor| Length = 1804 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 1 RGPGAPKEKPRSLSRPKRDGASLSPYLSDDQEQRIHFGDPARPG 132 +GP P KP RP DG P S + R G P PG Sbjct: 565 QGPPGPTGKPGKRGRPGADGGRGMPGESGSKGDRGFDGLPGLPG 608 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,095,015 Number of Sequences: 219361 Number of extensions: 946691 Number of successful extensions: 2431 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2431 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)