| Clone Name | bastl17b11 |
|---|---|
| Clone Library Name | barley_pub |
>MYC_AVIMD (P06295) Viral myc transforming protein (v-Myc)| Length = 416 Score = 31.6 bits (70), Expect = 0.80 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 310 RGLRRQPDLLQHG-YRQEETLPILPLGPSRRKTNAGSSSPPQDGEEI*GVAADLGG 146 RG QP +++ E LP+ PL PSRR + A +S P +++ V LGG Sbjct: 39 RGSELQPPAPSEDIWKKFELLPMPPLSPSRRSSLAAASCFPSTADQLEMVTELLGG 94
>MYC_AVIMC (P01110) Viral myc transforming protein (v-Myc)| Length = 416 Score = 31.6 bits (70), Expect = 0.80 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 310 RGLRRQPDLLQHG-YRQEETLPILPLGPSRRKTNAGSSSPPQDGEEI*GVAADLGG 146 RG QP +++ E LP+ PL PSRR + A +S P +++ V LGG Sbjct: 39 RGSELQPPAPSEDIWKKFELLPMPPLSPSRRSSLAAASCFPSTADQLEMVTELLGG 94
>MYC_CHICK (P01109) Myc proto-oncogene protein (c-myc)| Length = 416 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -2 Query: 310 RGLRRQPDLLQHG-YRQEETLPILPLGPSRRKTNAGSSSPPQDGEEI*GVAADLGG 146 RG QP +++ E LP PL PSRR + A +S P +++ V LGG Sbjct: 39 RGSELQPPAPSEDIWKKFELLPTPPLSPSRRSSLAAASCFPSTADQLEMVTELLGG 94
>MYC_AVIOK (P12523) Viral myc transforming protein (v-Myc)| Length = 416 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -2 Query: 310 RGLRRQPDLLQHG-YRQEETLPILPLGPSRRKTNAGSSSPPQDGEEI*GVAADLGG 146 RG QP +++ E LP PL PSRR + A +S P +++ V LGG Sbjct: 39 RGSELQPPAPSEDIWKKFELLPAPPLSPSRRSSLAAASCFPSTADQLEMVTELLGG 94
>MYC_AVIM2 (P10395) Viral myc transforming protein (v-Myc)| Length = 416 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -2 Query: 310 RGLRRQPDLLQHG-YRQEETLPILPLGPSRRKTNAGSSSPPQDGEEI*GVAADLGG 146 RG QP +++ E LP PL PSRR + A +S P +++ V LGG Sbjct: 39 RGSELQPPAPSEDIWKKFELLPTPPLSPSRRSSLAAASCFPSTADQLEMVTELLGG 94
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 30.4 bits (67), Expect = 1.8 Identities = 22/77 (28%), Positives = 31/77 (40%) Frame = +3 Query: 174 ISSPSCGGEEDPAFVFLLLGPRGKIGRVSSCL*PCWRRSGCRRSPRCEGRPXCWTRQTAR 353 +SSP C +P+ + G SSC PC+++S C +P C T Sbjct: 48 VSSPCCQTACEPSAC--------QSGYTSSCTTPCYQQSSC--------QPDCCT----- 86 Query: 354 AVPLSSPCYTEASLPRC 404 SSPC +P C Sbjct: 87 ----SSPCQQACCVPVC 99
>KRA24_HUMAN (Q9BYR9) Keratin-associated protein 2-4 (Keratin-associated protein| 2.4) (High sulfur keratin-associated protein 2.4) Length = 128 Score = 30.0 bits (66), Expect = 2.3 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +3 Query: 264 CL*PCWRRSGCRRSPRC--------EGRPXCWTRQTARAVPLSSPCYTEASLPRCG 407 C PC + GC R C RP CW + V + SPC P CG Sbjct: 63 CCDPCSLQEGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC----CRPPCG 114
>KRA3A_SHEEP (P02443) Keratin, high-sulfur matrix protein, IIIA3A| Length = 130 Score = 30.0 bits (66), Expect = 2.3 Identities = 30/112 (26%), Positives = 34/112 (30%), Gaps = 31/112 (27%) Frame = +3 Query: 156 SAATPQISSPSCGGE-------EDPA----------------FVFLLLGPRGKIGRVSSC 266 S P SS SCGG DP FV P + R C Sbjct: 3 SCCGPTFSSLSCGGGCLQPCCYRDPCCCRPVSSTQTVSRPVTFVSRCTRPICEPCRRPVC 62 Query: 267 L*PCWRRSGCRRSPRC--------EGRPXCWTRQTARAVPLSSPCYTEASLP 398 PC + GC R C RP CW + V + PC S P Sbjct: 63 CDPCSLQEGCCRPITCCPTSCQAVVCRPCCWATTCCQPVSVQCPCCRPTSCP 114
>US30_HCMVA (P09706) Hypothetical protein HHRF5| Length = 349 Score = 30.0 bits (66), Expect = 2.3 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 102 SPLRRRIRLGGVLFLPPRSAATPQISSPS 188 SPL RR+R V FLPPR AA+ ++ S Sbjct: 6 SPLDRRLRFRNVPFLPPRIAASSTTTARS 34
>MEGF6_RAT (O88281) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1574 Score = 29.6 bits (65), Expect = 3.0 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Frame = +3 Query: 135 VLFLPPRSAATP-------QISSPSCGGEEDPAFVFLLLGPRGKIGRVSSCL*PCWRRSG 293 +L LP AA+P Q S P E+ L+G R + S + P WRR+G Sbjct: 18 LLLLPAMPAASPPLTPRPLQPSMPHVCAEQK----LTLVGHRQPCVQAFSRIVPVWRRTG 73 Query: 294 CRRSPRCEGR 323 C + C G+ Sbjct: 74 CAQQAWCIGQ 83
>DLL3_XENLA (P54655) Homeobox protein DLL-3 (XDLL-3)| Length = 289 Score = 29.3 bits (64), Expect = 3.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 44 GYGDPTHPQHRHQALRLQILSPPATDPAR 130 GYG P HP H++ ++ PP+T P + Sbjct: 93 GYGSPYHPHHQYSGAYNRV-QPPSTQPEK 120
>BRCA2_RAT (O35923) Breast cancer type 2 susceptibility protein homolog| (Fanconi anemia group D1 protein homolog) Length = 3343 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 102 SPLRRRIRLGGVLFLPPRSAATPQISSPSCGGEEDP 209 +P RR+ + G LF P+ TP+ S S G E DP Sbjct: 145 APQRRKPVVSGSLFYTPKLEETPKHISESLGVEVDP 180
>BSN_MOUSE (O88737) Bassoon protein| Length = 3941 Score = 28.9 bits (63), Expect = 5.2 Identities = 30/109 (27%), Positives = 41/109 (37%) Frame = +3 Query: 72 TDTKRYACKSSPLRRRIRLGGVLFLPPRSAATPQISSPSCGGEEDPAFVFLLLGPRGKIG 251 T K + C + ++R LG + PRS + Q+ SP+ PA P GK Sbjct: 206 TQVKEWLCLNCQMQRA--LGMDMTTAPRSKSQQQLHSPALSPAHSPA-----KQPLGKPE 258 Query: 252 RVSSCL*PCWRRSGCRRSPRCEGRPXCWTRQTARAVPLSSPCYTEASLP 398 + RSPR G RQ A S P T+A+ P Sbjct: 259 Q--------------ERSPRGPGATQSGPRQAEAARATSVPGPTQATAP 293
>HEVE_HEVBR (P02877) Pro-hevein precursor (Major hevein) [Contains: Hevein| (Allergen Hev b 6); Win-like protein] Length = 204 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 153 LVGEKARRRAGSVAGGERICRRSAWCLCWGWVGS 52 L G + G AGG ++C + C WGW GS Sbjct: 11 LTGVAIAEQCGRQAGG-KLCPNNLCCSQWGWCGS 43
>POLG_HCVTW (P29846) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 135 VLFLPPRSAATPQISSPSCGGEEDPAFVFLLLGPRGKI 248 +L LPPR+ A + + SCGG V L L P K+ Sbjct: 799 LLALPPRAYAMDREMAASCGGAVFVGLVLLTLSPHYKM 836
>POLG_HCVJT (Q00269) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 135 VLFLPPRSAATPQISSPSCGGEEDPAFVFLLLGPRGKI 248 +L LPPR+ A + + SCGG + L L P K+ Sbjct: 799 LLALPPRAYAMDREMAASCGGVVFVGLILLTLSPHYKV 836
>POLG_HCVJA (P26662) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 135 VLFLPPRSAATPQISSPSCGGEEDPAFVFLLLGPRGKI 248 +L LPPR+ A + + SCGG V L L P K+ Sbjct: 799 LLALPPRAYAMDREMAASCGGAVFVGLVLLTLSPYYKV 836
>POLG_HCVCO (Q9WMX2) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 135 VLFLPPRSAATPQISSPSCGGEEDPAFVFLLLGPRGKI 248 +L LPPR+ A + + SCGG + L L P K+ Sbjct: 799 LLALPPRAYAMDREMAASCGGAVFVGLILLTLSPHYKL 836
>POLG_HCVBK (P26663) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 135 VLFLPPRSAATPQISSPSCGGEEDPAFVFLLLGPRGKI 248 +L LPPR+ A + + SCGG V L L P K+ Sbjct: 799 LLALPPRAYAMDREMAASCGGAVFVGLVLLTLSPYYKV 836
>TILS_RHIME (Q92JY3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 453 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -2 Query: 271 YRQEETLPILPLGPSRRKTNAGSSSPPQDGEEI*GVAADLGGR 143 YR+ LP+L +GP R+ G + G + VAAD GR Sbjct: 324 YREARNLPVLAVGPGRQGAWDGRFTVKSRGPAV-TVAADASGR 365 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,694,321 Number of Sequences: 219361 Number of extensions: 1200723 Number of successful extensions: 3287 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 3171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3287 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)