Clone Name | bastl17b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YD14_SCHPO (Q10237) Hypothetical protein C4G9.04c in chromosome I | 41 | 6e-04 | 2 | PCF11_HUMAN (O94913) Pre-mRNA cleavage complex 2 protein Pcf11 (... | 39 | 0.002 | 3 | PCF11_YEAST (P39081) Protein PCF11 (protein 1 of CF I) | 35 | 0.043 | 4 | MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9) | 28 | 5.3 | 5 | EPOR_MOUSE (P14753) Erythropoietin receptor precursor (EPO-R) | 28 | 6.9 |
---|
>YD14_SCHPO (Q10237) Hypothetical protein C4G9.04c in chromosome I| Length = 638 Score = 41.2 bits (95), Expect = 6e-04 Identities = 27/59 (45%), Positives = 29/59 (49%) Frame = +1 Query: 223 YKEALAELTFNCKPIITELTIIAGQHXXXXXXXXXXXXXXXXLEVPVEQKLPALYLLDS 399 Y AL +LTFN KPII LT IA Q + P KLPALYLLDS Sbjct: 8 YLSALEDLTFNSKPIIHTLTYIA-QENEPYAISIVNAIEKHIQKCPPNCKLPALYLLDS 65
>PCF11_HUMAN (O94913) Pre-mRNA cleavage complex 2 protein Pcf11 (Pre-mRNA| cleavage complex II protein Pcf11) (Fragment) Length = 1654 Score = 39.3 bits (90), Expect = 0.002 Identities = 21/59 (35%), Positives = 31/59 (52%) Frame = +1 Query: 223 YKEALAELTFNCKPIITELTIIAGQHXXXXXXXXXXXXXXXXLEVPVEQKLPALYLLDS 399 Y+ +L +LTFN KP I LTI+A ++ + P +KLP +YL+DS Sbjct: 121 YQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEAQTA-KAPSSEKLPVMYLMDS 178
>PCF11_YEAST (P39081) Protein PCF11 (protein 1 of CF I)| Length = 626 Score = 35.0 bits (79), Expect = 0.043 Identities = 23/63 (36%), Positives = 31/63 (49%) Frame = +1 Query: 211 VVGVYKEALAELTFNCKPIITELTIIAGQHXXXXXXXXXXXXXXXXLEVPVEQKLPALYL 390 +V + L ELTFN +PIIT LT +A ++ +P +QKL A Y Sbjct: 8 IVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMP-KQKLYAFYA 66 Query: 391 LDS 399 LDS Sbjct: 67 LDS 69
>MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9)| Length = 567 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +1 Query: 136 VVGQVVERFRARLREEAGEEPKAAAVVGVYKEALAELTFNC 258 V G+VVE AR+ E G+E G+YKEA T C Sbjct: 501 VFGRVVEEEMARIEREVGKEKFKK---GMYKEACKIFTRQC 538
>EPOR_MOUSE (P14753) Erythropoietin receptor precursor (EPO-R)| Length = 507 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 10 PAWPCFASACLLLVASLPNPSPRRPFPE 93 P WP CLLL + PSP P P+ Sbjct: 7 PLWPRVGPLCLLLAGAAWAPSPSLPDPK 34 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,313,246 Number of Sequences: 219361 Number of extensions: 378464 Number of successful extensions: 1062 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)