Clone Name | bastl16g03 |
---|---|
Clone Library Name | barley_pub |
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S ++ P ++ +A VPLAP +PP+P+P R A Sbjct: 1123 SDKEAPPPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 133 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 117 IRFGDGAGGLARVRGASGTEATRRCCVGVY 28 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 611 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 647
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 592 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 628 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +2 Query: 8 KRRSSRK*TPTQQRRVASVPLAPRTLASPP---APSPNRIRP 124 +RRS P ++RR + P RT + PP +PSP R P Sbjct: 557 RRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSP 598
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 585 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 621
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 606 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 642 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +2 Query: 8 KRRSSRK*TPTQQRRVASVPLAPRTLASPP---APSPNRIRP 124 +RRS P ++RR + P RT + PP +PSP R P Sbjct: 571 RRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSP 612
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 130 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>BORG5_HUMAN (Q00587) Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum| protein MSE55) Length = 391 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 14 RSSRK*TPTQQRRVASVPLAPRTLASPPAPSP 109 RS R + + V V PR +ASPPAPSP Sbjct: 76 RSPRSFLAKKLQLVRRVGAPPRRMASPPAPSP 107
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNR 115 S ++ P ++ + VPLAP +PP+P+P R Sbjct: 1123 SDKEAPPPKEGTLTQVPLAPPPPGAPPSPAPAR 1155
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S ++ P ++ + VPLAP +PP+P+P R A Sbjct: 1118 SDKEAPPPKEGVLGQVPLAPPQPGAPPSPAPARFSTA 1154
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 4 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 99 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 4 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 99 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 4 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 99 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>CHS4_NEUCR (Q01285) Chitin synthase 4 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 4) (Class-IV chitin synthase 4) Length = 1195 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASPPAPSPN 112 P+QQ+RV S+ P TL P+P+PN Sbjct: 6 PSQQQRVPSISSFPETL---PSPNPN 28
>PHF1_HUMAN (O43189) PHD finger protein 1 (PHF1 protein)| Length = 567 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASPPAPSPNR 115 P +QR A + A + SPP+PSPN+ Sbjct: 399 PQEQRERAHLQRALQASVSPPSPSPNQ 425
>BORG5_MOUSE (Q91W92) Cdc42 effector protein 1 (Binder of Rho GTPases 5)| Length = 409 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 14 RSSRK*TPTQQRRVASVPLAPRTLASPPAPSP 109 RS R + ++V V + PR +ASP APSP Sbjct: 76 RSPRSFLARKLQQVRRVGVPPRRMASPAAPSP 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.305 0.118 0.324 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,657,893 Number of Sequences: 219361 Number of extensions: 243947 Number of successful extensions: 1351 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)