| Clone Name | bastl16f07 |
|---|---|
| Clone Library Name | barley_pub |
>RBM28_HUMAN (Q9NW13) RNA-binding protein 28 (RNA-binding motif protein 28)| Length = 758 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSE 313 T+FV LP + +S LE +FS+VGPV++CF+V KGS+ Sbjct: 4 TLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSK 41
>RBM28_MOUSE (Q8CGC6) RNA-binding protein 28 (RNA-binding motif protein 28)| Length = 749 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSE 313 T+FV LP + +S LE +FS+VGPV++CF+V KGS+ Sbjct: 4 TLFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSK 41
>MRD1_ASPFU (Q4WJT7) Multiple RNA-binding domain-containing protein 1| Length = 825 Score = 35.4 bits (80), Expect = 0.036 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 S +FV NLPY SDLE VFS+ G + + S TS Sbjct: 301 SRLFVRNLPYDASESDLEPVFSKFGKIEEIHVAFDTRSTTS 341
>CSTF2_BOVIN (Q8HXM1) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 572 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 +VFV N+PY L+ +FSEVGPV Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPV 42
>CSTF2_MOUSE (Q8BIQ5) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 580 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 +VFV N+PY L+ +FSEVGPV Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPV 42
>CSTF2_PONPY (Q5RDA3) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 577 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 +VFV N+PY L+ +FSEVGPV Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPV 42
>CSTF2_HUMAN (P33240) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 577 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 +VFV N+PY L+ +FSEVGPV Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGPV 42
>RBM19_HUMAN (Q9Y4C8) Probable RNA-binding protein 19 (RNA-binding motif protein| 19) Length = 960 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPV 277 +FV NLPYT DLE +FS+ GP+ Sbjct: 404 LFVRNLPYTSTEEDLEKLFSKYGPL 428 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 T+F+ NL + L+ VFS+VG V+ C + K Sbjct: 731 TLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKK 765
>RU17_XENLA (P09406) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 32.7 bits (73), Expect = 0.23 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 T+FV+ + Y S L F GP++R +V +KGSE S Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHIVYNKGSEGS 143
>HRB1_YEAST (P38922) Protein HRB1 (Protein TOM34)| Length = 429 Score = 32.3 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKG 307 +++FV NL Y DL FS++G V R ++ S+G Sbjct: 136 NSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRG 172 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRRC-FMVASKGSET 316 ++ SNLP++ SDL +F +G V SKG+ T Sbjct: 353 IYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPT 391
>PES4_YEAST (P39684) Protein PES4 (DNA polymerase epsilon suppressor 4)| Length = 611 Score = 32.0 bits (71), Expect = 0.40 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 191 SPSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFM 292 S +++F+ NLP D+ FSEVGP++ ++ Sbjct: 301 SQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYL 334
>CTF1_SCHPO (O43040) Cleavage and termination factor 1 (Transcription| termination factor ctf1) Length = 363 Score = 31.6 bits (70), Expect = 0.52 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVR 280 + VFV N+PY + +F++VGPV+ Sbjct: 7 NVVFVGNIPYDVSEQQMTEIFNQVGPVK 34
>CSTFT_MOUSE (Q8C7E9) Cleavage stimulation factor, 64 kDa subunit, tau variant| (CSTF 64 kDa subunit, tau variant) (CF-1 64 kDa subunit, tau variant) (TauCstF-64) Length = 632 Score = 30.8 bits (68), Expect = 0.89 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 +VFV N+PY L+ +FSEVG V Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGSV 42
>CSTFT_HUMAN (Q9H0L4) Cleavage stimulation factor, 64 kDa subunit, tau variant| (CSTF 64 kDa subunit, tau variant) (CF-1 64 kDa subunit, tau variant) (TauCstF-64) Length = 616 Score = 30.8 bits (68), Expect = 0.89 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 +VFV N+PY L+ +FSEVG V Sbjct: 17 SVFVGNIPYEATEEQLKDIFSEVGSV 42
>NIA_VOLCA (P36841) Nitrate reductase [NADH] (EC 1.7.1.1) (NR)| Length = 864 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -3 Query: 304 FRRDHEAAPHRPDLAEHRLEIGGLV 230 F R+H AAP P AEHR+EI GLV Sbjct: 91 FVRNHGAAPRIP-WAEHRIEINGLV 114
>FOX1_CAEEL (Q10572) Sex determination protein fox-1 (Feminizing locus on X| protein 1) Length = 415 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPV 277 P + VSN+P+ ++ DL+T+F + G V Sbjct: 152 PKRLHVSNIPFRFRDPDLKTMFEKFGVV 179
>SFRS1_ARATH (O22315) Pre-mRNA-splicing factor SF2 (SR1 protein)| Length = 303 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 191 SPSTVFVSNLPYTYKSSDLETVFSEVGPV 277 S TV+V NLP + ++E +FS+ GPV Sbjct: 5 SSRTVYVGNLPGDIREREVEDLFSKYGPV 33
>RBM19_MOUSE (Q8R3C6) Probable RNA-binding protein 19 (RNA-binding motif protein| 19) Length = 952 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPV 277 +FV NL YT DLE +FS GP+ Sbjct: 402 LFVRNLSYTSSEEDLEKLFSAYGPL 426 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 T+F+ NL ++ L+ VFS+VG ++ C + K Sbjct: 723 TLFIKNLNFSTTEETLKGVFSKVGAIKSCTISKKK 757
>RU17_HUMAN (P08621) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 437 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGS 310 T+FV+ + Y S L F GP++R MV SK S Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS 140
>ROC5_NICSY (P19684) 33 kDa ribonucleoprotein, chloroplast precursor| Length = 324 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 ++V NLP++ SS L +F+E G V +V + ++ S Sbjct: 116 LYVGNLPFSMTSSQLSEIFAEAGTVANVEIVYDRVTDRS 154
>RU17_MOUSE (Q62376) U1 small nuclear ribonucleoprotein 70 kDa (U1 SNRNP 70| kDa) (snRNP70) Length = 448 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGS 310 T+FV+ + Y S L F GP++R MV SK S Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS 140
>RNPC2_MOUSE (Q8VH51) RNA-binding region-containing protein 2 (Coactivator of| activating protein 1 and estrogen receptors) (Coactivator of AP-1 and ERs) (Transcription coactivator CAPER) Length = 530 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 TVF L + DLE FS VG VR M++ + S S Sbjct: 154 TVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRS 193
>RNPC2_HUMAN (Q14498) RNA-binding region-containing protein 2 (Hepatocellular| carcinoma protein 1) (Splicing factor HCC1) Length = 530 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 TVF L + DLE FS VG VR M++ + S S Sbjct: 154 TVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRS 193
>RAVR2_HUMAN (Q9HCJ3) Protein raver-2| Length = 691 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 209 VSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 ++N+P ++ S + E + G + RCF+V S+ Sbjct: 146 ITNVPISFTSEEFEELVRAYGNIERCFLVYSE 177
>TIA1_MOUSE (P52912) Nucleolysin TIA-1 (RNA-binding protein TIA-1)| Length = 386 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFMV 295 P T++V NL + + +FS++GP + C M+ Sbjct: 6 PKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMI 39
>TIA1_HUMAN (P31483) Nucleolysin TIA-1 isoform p40 (RNA-binding protein TIA-1)| (p40-TIA-1) [Contains: Nucleolysin TIA-1 isoform p15 (p15-TIA-1)] Length = 386 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFMV 295 P T++V NL + + +FS++GP + C M+ Sbjct: 6 PKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMI 39
>PPIL4_MOUSE (Q9CXG3) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-like protein PPIL4) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMV 295 + +FV L DLE +FS GP+R C ++ Sbjct: 240 NVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVI 272
>PPIL4_HUMAN (Q8WUA2) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-like protein PPIL4) Length = 492 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMV 295 + +FV L DLE +FS GP+R C ++ Sbjct: 240 NVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVI 272
>GBP2_YEAST (P25555) Single-strand telomeric DNA-binding protein GBP2| (G-strand-binding protein 2) (RAP1 localization factor 6) Length = 427 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKG 307 +++FV NL + DL+ +F VG V ++ SKG Sbjct: 122 NSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKG 158
>RALY_MOUSE (Q64012) RNA-binding protein Raly (hnRNP associated with lethal| yellow protein) (Maternally expressed hnRNP C-related protein) Length = 312 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 197 STVFVSNL-PYTYKSSDLETVFSEVGPVRRC 286 S VF+ NL K SD+ET+FS+ G V C Sbjct: 21 SRVFIGNLNTAVVKKSDVETIFSKYGRVAGC 51
>HNRPM_HUMAN (P52272) Heterogeneous nuclear ribonucleoprotein M (hnRNP M)| Length = 729 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSET 316 STVFV+NL Y L+ VFS G V R ++ K ++ Sbjct: 203 STVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKS 242
>RSP31_ARATH (P92964) Arginine/serine-rich splicing factor RSP31| Length = 264 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRRCFM 292 VFV N Y + SDLE +F + G V R M Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDM 33
>MSI2H_MOUSE (Q920Q6) RNA-binding protein Musashi homolog 2 (Musashi-2)| Length = 346 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = +2 Query: 188 HSPSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 H P +F+ L + L FS+ G +R C ++ ++ S Sbjct: 18 HDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRS 61
>RU17_XENTR (Q66II8) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 471 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGS 310 T+FV+ + Y S L F GP++R MV +K S Sbjct: 104 TLFVARVNYDTTESKLRREFEVYGPIKRIHMVYNKRS 140
>RU17_ARATH (Q42404) U1 small nuclear ribonucleoprotein 70 kDa (U1 snRNP 70| kDa) (snRNP70) (U1-70K) Length = 427 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 T+FVS L Y S ++ F GP++R +V + Sbjct: 139 TLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQ 173
>RALY_HUMAN (Q9UKM9) RNA-binding protein Raly (hnRNP associated with lethal| yellow homolog) (Autoantigen p542) Length = 306 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 197 STVFVSNLPYTY-KSSDLETVFSEVGPVRRC 286 S VF+ NL K SD+ET+FS+ G V C Sbjct: 21 SRVFIGNLNTALVKKSDVETIFSKYGRVAGC 51
>MSI2H_HUMAN (Q96DH6) RNA-binding protein Musashi homolog 2 (Musashi-2)| Length = 328 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = +2 Query: 188 HSPSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 H P +F+ L + L FS+ G +R C ++ ++ S Sbjct: 18 HDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRS 61
>HNRPM_RAT (Q62826) Heterogeneous nuclear ribonucleoprotein M (hnRNP M) (M4| protein) Length = 689 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSET 316 STVFV+NL Y L+ VFS G V R ++ K ++ Sbjct: 163 STVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKS 202
>HNRPM_MOUSE (Q9D0E1) Heterogeneous nuclear ribonucleoprotein M (hnRNP M)| Length = 728 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSET 316 STVFV+NL Y L+ VFS G V R ++ K ++ Sbjct: 202 STVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKS 241
>RSD1_SCHPO (O13845) RNA-binding protein rsd1| Length = 604 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 TVFVS L S +L F + GPVR +V K S S Sbjct: 241 TVFVSQLANRLTSRELYDFFEQAGPVRDAQIVRDKISGRS 280
>RBM34_RAT (Q5M9F1) RNA-binding protein 34 (RNA-binding motif protein 34)| Length = 428 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 TVFV NLP T L++ F E G V Sbjct: 184 TVFVGNLPVTCNKKKLKSFFKEYGQV 209
>RBM34_MOUSE (Q8C5L7) RNA-binding protein 34 (RNA-binding motif protein 34)| Length = 375 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 TVFV NLP T L++ F E G V Sbjct: 190 TVFVGNLPVTCNKKKLKSFFKEYGQV 215
>YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in chromosome III| Length = 654 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 VF+ NLP +Y ++E F + G + +++ K Sbjct: 301 VFIGNLPSSYHEKEIEEAFGKFGKIEHIKILSKK 334
>RBM9_HUMAN (O43251) RNA-binding protein 9 (RNA-binding motif protein 9)| (Hexaribonucleotide-binding protein 2) (Repressor of tamoxifen transcriptional activity) Length = 390 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 191 SPSTVFVSNLPYTYKSSDLETVFSEVGPV 277 +P + VSN+P+ ++ DL +F + G + Sbjct: 119 TPKRLHVSNIPFRFRDPDLRQMFGQFGKI 147
>ROC1_SPIOL (P28644) 28 kDa ribonucleoprotein, chloroplast (28RNP)| Length = 233 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 V+V NLP+ +S LE +FSE G V +V+ + Sbjct: 151 VYVGNLPWDVDTSRLEQLFSEHGKVVSARVVSDR 184
>PM14_MOUSE (P59708) Pre-mRNA branch site protein p14 (SF3B 14 kDa subunit)| Length = 125 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRR 283 +++ NLPY + ++ +F + GP+R+ Sbjct: 21 LYIRNLPYKITAEEMYDIFGKYGPIRQ 47
>PM14_HUMAN (Q9Y3B4) Pre-mRNA branch site protein p14 (SF3B 14 kDa subunit)| Length = 125 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = +2 Query: 203 VFVSNLPYTYKSSDLETVFSEVGPVRR 283 +++ NLPY + ++ +F + GP+R+ Sbjct: 21 LYIRNLPYKITAEEMYDIFGKYGPIRQ 47
>A2BP1_MOUSE (Q9JJ43) Ataxin-2-binding protein 1| Length = 396 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPV 277 P + VSN+P+ ++ DL +F + G + Sbjct: 115 PKRLHVSNIPFRFRDPDLRQMFGQFGKI 142
>A2BP1_HUMAN (Q9NWB1) Ataxin-2-binding protein 1| Length = 397 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPV 277 P + VSN+P+ ++ DL +F + G + Sbjct: 116 PKRLHVSNIPFRFRDPDLRQMFGQFGKI 143
>RAVR2_MOUSE (Q7TPD6) Protein raver-2| Length = 673 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 209 VSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 ++NLP ++ + E + G + RCF+V S+ Sbjct: 135 ITNLPISFTLEEFEELVRAYGNIERCFLVYSE 166
>RBM34_HUMAN (P42696) RNA-binding protein 34 (RNA-binding motif protein 34)| Length = 430 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPV 277 TVFV NLP T L++ F E G + Sbjct: 186 TVFVGNLPVTCNKKKLKSFFKEYGQI 211 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 +VFV NLPY + S +E F + G + +V K Sbjct: 288 SVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDK 322
>RBM23_HUMAN (Q86U06) Probable RNA-binding protein 23 (RNA-binding motif protein| 23) (RNA-binding region-containing protein 4) (Splicing factor SF2) Length = 439 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 200 TVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSETS 319 TVF L + DLE FS VG VR +++ + S S Sbjct: 167 TVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRS 206
>RNP24_SCHPO (Q09100) RNA-binding protein rnp24| Length = 369 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRR 283 S +FV NL + +DL+ F +VG +RR Sbjct: 228 SILFVGNLDFETTDADLKEHFGQVGQIRR 256
>TIAR_HUMAN (Q01085) Nucleolysin TIAR (TIA-1-related protein)| Length = 375 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGS 310 P T++V NL + +FS++GP + C M+ S Sbjct: 8 PRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTS 46
>MYEF2_MOUSE (Q8C854) Myelin expression factor 2 (MyEF-2) (MEF-2)| Length = 591 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSET 316 ST+FV+NL + L+ VFS G V+R + K ++ Sbjct: 224 STIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKS 263
>MYEF2_HUMAN (Q9P2K5) Myelin expression factor 2 (MyEF-2) (MST156)| Length = 600 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASKGSET 316 ST+FV+NL + L+ VFS G V+R + K ++ Sbjct: 233 STIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKS 272
>TIAR_MOUSE (P70318) Nucleolysin TIAR (TIA-1-related protein)| Length = 392 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 194 PSTVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 P T++V NL + +FS++GP + C M+ + Sbjct: 8 PRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQ 44
>PPIL4_ASPFU (Q4WAQ9) Peptidyl-prolyl cis-trans isomerase-like 4 (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 459 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 197 STVFVSNLPYTYKSSDLETVFSEVGPVRRCFMVASK 304 + +FV L + DL+ +FS GP+ C ++ K Sbjct: 248 NVLFVCKLNPVTQDEDLQLIFSRFGPILSCEVIRDK 283
>HNRCL_HUMAN (O60812) Heterogeneous nuclear ribonucleoprotein C-like 1 (hnRNP| core protein C-like 1) Length = 293 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 197 STVFVSNL-PYTYKSSDLETVFSEVGPVRRC 286 S VF+ NL K SD+E +FS+ G + C Sbjct: 16 SRVFIGNLNTLVVKKSDVEAIFSKYGKIAGC 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,422,820 Number of Sequences: 219361 Number of extensions: 287460 Number of successful extensions: 1398 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1398 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)